KEGG   Leishmania infantum: LINJ_32_3060Help
Entry
LINJ_32_3060      CDS       T01112                                 

Definition
putative cysteine peptidase, Clan CA, family C19
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LINJ_32_3060
Peptidases [BR:lif01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LINJ_32_3060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32:complement(1148537..1152562)
Genome map
AA seq 1341 aa AA seqDB search
MSSEGALSSGDAMEEMELKERNHSIEGSSFTATTRDSFASAEEDSTASQVNEEACMATGK
PRTITWNGTATTAHDYTAASTAETDDEENAAVVAQPQLPLDRLQAYIQALVGNILESLRG
FDGSITWLKRSHSAIAAHLDGINAGAVPAATEEFSVAWFGIASAVLHDLIQESVADIFAL
ATPPLLSSENEESARGLCVTPHELSVAFVSGLQSIVSEVMNDGGCHGSGGSHHFSRYSLR
SFAHVKEISEMSRRLMEEHLTQGAHVPHALRNKYSDDTTPIDCKEDLCSILQSTADAWVC
SFFPAYQQRSRNPTEVAPFLWGEEEDASRLNLELFFYCLYFACQQRSLMQNREALPRGVV
VPTAWMEQLLRWSTQAKEQHCLASPGPHPPFPGPIDTFALMTVSPHDPRRHWLSLDSERY
QVIPETLYNSFFDFFGTGPKYVMYGAFPLRERCLLMWKPLPLTVFTTFEWWERNESDGAL
DKYSVEVPVEEALLHSDMREVCHLAWGVMREEEGMMSDKVARVWFAAINGTDTVRICCKG
LYMLSVKTGPFTIAERGDGMDVTVQEILQQLRRRIEQYMPESVEEWRLQTSGKVLLSLVL
TLNNTNGDDGGGEITRTMEVAAHQCGVCGLTNVGNTCYMNSALQCLSNLTSFRTKLLTLP
ISHFSQAVITPLLIRLLTTMWSGQHSFAETRELKEQIGMRVKRFSGYQQQDANEFIEVLL
DHLSEEINLLSERCYRQREDSDKAIATQELSTIFWSNFLENNKSFIPPLFFHQSKTVFTC
LTCGECSTVFDNNVTLSVSIKDPPQRRAMSVDVMVELSKSDDAAEPVSHSGFMAPLFRPV
KGGTARAHALVTLKVHVLVQPDNTVREQEVEEALRQLLLSNASASREVLRFFLDGSADEM
TAEEEKQRARSVAARVQVDVRVMDIPDHGRVFAWARCYLASADLSVASAPPPTTVGAAGA
PAARVWYFMKDAPLPSTTAIIGTPVWIDEFPASYGAEHPQPAAVDAADAEGLVLASEPRD
CMTAYAEHIRPRSLEVATALLQRVPEDETDEVALFTPTETLSGGAGYVTPPSHKHEAKGK
LASANDAGAAAASIERDIKIVQRILRKSTTASVTKTTSTGDDINTDATGSEACEKAPAST
ALTTTIVVCIQYDSAKYQLVTDGRSSDAFGLRGVGSDITPEVKCSLHECLSHSMQPDLLR
GEDAWFCSRCKEFRETKVHRTLFRLPPCLIVSFKRFKMHTYSADKKNTTVQFPSELDFAP
YLDPESAGLQTEGTKYRLRGVVYHTGSLSFGHYTAAAFNDSVKKWVYYNDTHATIDSCDA
PAPNGAYILCFERVEATASPA
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgaaggagctctgagctctggggacgctatggaggagatggagctgaaggag
agaaaccacagcattgaaggatcttcgtttaccgccactacccgtgacagcttcgcctct
gcagaagaagactcgacagcatcacaggtcaacgaagaagcgtgcatggctaccggcaag
ccgagaaccataacttggaatgggacggctacgacagcgcatgactacaccgctgcttct
acggctgaaacggatgacgaggagaatgctgccgtggtggcgcagccgcagcttccgctc
gaccgactccaggcttatattcaggcgcttgtgggaaacatcttggagagccttcgcggg
ttcgacggcagcatcacatggctaaagcgctcacactcggccatcgcagcccacctggac
ggcatcaacgccggggctgttccggccgcaacggaggagtttagcgttgcctggttcggt
atcgcaagcgctgtgctgcatgacttgatccaagaaagcgtagcggacattttcgctctc
gcgacgccgccgcttctgtccagcgagaatgaggaatcagcgcgtgggttgtgcgtgacg
ccgcacgagctgtccgttgcctttgtctcgggtttgcagagcattgtttcggaggtgatg
aatgacggcgggtgccatggctcgggtggcagccaccacttcagccgctactccttgcgc
agttttgcccatgtaaaggagatcagcgagatgagccgccgtctcatggaggaacacttg
acgcagggagcacacgtgccgcacgcgctgcgcaacaagtacagcgacgatacgacccct
atcgactgcaaggaggacctctgctccattctccagagcactgctgatgcgtgggtgtgc
agcttctttccagcctaccagcagcgctctcgcaacccaacagaggtggcgccgtttctg
tggggggaggaagaggacgcctcgcgccttaacctggagctgttcttttactgcttgtac
tttgcttgtcagcagcggagcttgatgcagaacagggaagctcttccgcgcggcgttgtg
gtgccgacggcgtggatggagcagctgctgaggtggtccacgcaagcgaaggagcagcac
tgcttggcctcacccgggccacacccaccttttccgggcccgatcgacacgttcgcgctc
atgacggtctcgccgcacgacccgcgccggcactggctttctctagactcggagcgatac
caggtgattccagagactctgtacaactccttctttgacttctttggcaccggccccaag
tacgtcatgtatggagcctttcctctgcgggagcgctgtctcctcatgtggaagccgctt
ccgctgaccgtgttcacgacatttgagtggtgggagcggaacgaatcggacggagcgctt
gacaagtacagcgtagaggtgcccgtggaggaggcactcctgcatagcgacatgcgcgag
gtgtgccacctcgcctggggcgtgatgagggaggaggagggcatgatgtcggacaaggtg
gccagagtgtggtttgcggcaatcaacggaaccgacacggtgcgcatctgctgcaaaggc
ctctacatgctttccgtgaaaacaggtccgttcacgattgcagaaaggggggatgggatg
gacgtgaccgtgcaggagatattgcagcagctgcggcggcgcatcgagcagtatatgccg
gagagcgtggaggagtggaggctgcagacgagcgggaaggtgctcttgtccctggtgctg
acgctgaacaacacaaacggcgacgacggcggaggcgaaattacacgcacgatggaggtg
gcagcacaccaatgcggtgtgtgcggcctgaccaatgtcggcaacacatgctacatgaac
agtgcccttcagtgcttgtcgaatctcacctccttccgcacgaagcttttgacgcttccc
atttcgcacttttcacaggcggttataactccgctgctcattaggctgctgacgacgatg
tggtctgggcagcactccttcgcggagacccgtgagcttaaggagcagattggtatgcga
gtgaagcgtttttctggctaccagcagcaagatgcaaatgagttcatagaagtgctcctg
gatcacctgagtgaggagatcaatctcctctcggagcgatgctaccgacagcgcgaggac
agcgacaaggcgatcgcgacgcaggagctctccaccatcttctggagcaacttcttggaa
aacaacaagtcgttcataccgcccctcttcttccaccagtcgaagaccgtcttcacatgc
ctcacctgtggggagtgcagcaccgtcttcgacaacaacgtcacgctctccgtcagcatc
aaagacccgccgcagcggcgcgccatgagcgtggatgttatggtggagctaagcaagtct
gacgacgcggccgagcccgtctcacacagcggcttcatggcaccgctgtttcgacctgtg
aaggggggcacggcccgtgcgcacgcgctggtgacgctgaaggttcacgtgctggtgcag
ccagacaacacggtgcgcgagcaggaggtggaggaggcgcttcgacagctgctgctgagc
aatgccagtgctagcagagaggtgctgcgcttttttctggacggctctgcagatgagatg
actgcggaggaggaaaagcagagggcaaggagtgtggcagcgcgcgtgcaggtggacgtg
cgcgtaatggacattcctgatcatggtcgcgtgtttgcttgggcacggtgctacctggcg
agcgcagatctgagcgtggcatctgcgccgccaccgactacagtgggtgcagcaggggcg
cctgcggcacgtgtgtggtacttcatgaaggatgcaccgcttccctccacgactgccata
ataggcaccccggtttggatcgacgagtttccggcgtcttacggtgcggagcacccgcag
cctgcggccgtagatgccgccgacgcggaggggctcgttttggccagcgaaccccgtgac
tgcatgaccgcctacgcggagcacatccgcccgcgctctttagaggtggcgacagcactt
cttcaacgcgttccagaagacgagacggacgaggtagcgctcttcactcccacagagact
ctaagcggaggggcagggtacgtcacgcctccatcccacaagcacgaagccaaaggaaag
ctggcgtccgccaacgacgccggcgcagcggctgcatccattgagcgagacatcaagata
gttcagcgcattctccgcaaatccacaaccgccagcgtcacaaaaaccacatccacgggc
gacgacattaacacagatgcgacagggagcgaggcctgtgaaaaggcgccagcttccacg
gcgctgacgaccaccattgtcgtgtgcatccagtacgactctgccaagtatcagctcgtt
accgacggacggagttcggatgcctttggactccgcggcgtaggtagcgacatcaccccg
gaggtgaaatgctcgctgcacgagtgcttgtcgcactctatgcagccggacctgctgcgg
ggcgaggatgcctggttctgcagtcggtgcaaggagtttcgggagacgaaagtgcaccgc
accctcttccgtctgcccccgtgcctcattgtgtcctttaagcgctttaagatgcacacg
tacagcgccgacaagaagaacaccacagtgcagttccccagcgagctcgactttgcgccg
tacctggaccccgaatccgctggacttcagacggagggcacgaagtaccgcctgcgcggt
gtggtgtaccacaccgggtcgctcagctttgggcattacactgcggccgccttcaacgat
tccgtgaagaaatgggtatactacaacgacacacacgcgacgatcgacagctgcgacgcc
ccagcgccgaatggggcgtacattttgtgttttgagcgcgttgaagctacggcaagtcca
gcgtaa

DBGET integrated database retrieval system