KEGG   Leishmania infantum: LINJ_32_3830Help
Entry
LINJ_32_3830      CDS       T01112                                 

Definition
putative 3-hydroxyisobutyryl-coenzyme A hydrolase (EC:4.2.1.17)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
lif  Leishmania infantum
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LINJ_32_3830
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LINJ_32_3830
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LINJ_32_3830
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LINJ_32_3830
Enzymes [BR:lif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     LINJ_32_3830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32:1441208..1442323
Genome map
AA seq 371 aa AA seqDB search
MYRTGARCSASVLCKDYPHARHITLNRPNSLNALDYGMIRELHRLYVTEPAPPSSLYILT
GAGTKAFCAGGDVIGLATNNPPGCGREFFYWEYQVDYKASIIPAGQVCLWDGYVLGGGAG
LSIGSAYRVASEKACFAMPEVAIGMFPDVGASWFLPRLSVPGLGLYMGLTGHRLRGADLV
HLGLATHFVPSAKMGELEQALVSMSDAGDVEAVLDKYTTPIAQLPPCTIAYSISSLADHF
DITADLTVSSILDACRANAQTDPLTKAAADLMPSFSPTAMTLALELLKRGAKLSTPVEAF
QMEYCVSQRIMAEHDFREGVRALLIDKDKKPKWQPSTVAEVAAEAIDAYFRPTTPNQPVW
DPVAPLSEPAA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgcacgggcgcgcgttgcagcgcgagcgtgctgtgcaaagactacccgcatgcg
cgccacattaccctcaaccggcccaattcactgaacgcgctggattatggcatgatacgg
gagctgcaccgtctgtacgtgacagagccagctcctccgtcatccctgtacatcctcacc
ggggcgggcacaaaggcattctgcgccggcggcgatgtgatcggcctcgcgacgaacaac
ccgcccggatgcggtcgtgaattcttctactgggagtaccaagtagactacaaggcgagc
atcattcctgctgggcaggtgtgcttgtgggacggctacgtgctcggcggcggcgctggc
ttatcgattggaagcgcttatcgggtggcgtcggagaaggcgtgctttgcaatgcctgag
gtggccataggtatgttccccgacgtaggggcttcgtggttcctgccgcggctgtcggtg
cctgggctggggctctatatggggctcaccggccaccggctccgcggggccgaccttgtg
caccttgggcttgcaacacactttgtgccatctgccaagatgggcgagctggagcaggct
ctcgtctcgatgtcggacgcaggtgatgtggaggcggtgctggacaagtacacgacaccg
atagcgcagctgccaccatgcaccatcgcctattccatttcttctctcgccgatcatttt
gacatcacggcagatctaaccgtatcgtccatcttggacgcgtgcagagcgaatgcgcag
acggatccgctgaccaaggcagcggcggatctcatgccctccttctccccgacggcaatg
acgctcgcactggagctgctgaagcgcggcgcgaagctgagcacacccgtggaggcgttc
cagatggagtactgcgtttcccagcgcatcatggcggaacacgactttcgcgaaggtgtg
cgagccctgctcatcgataaagacaagaagccgaaatggcaaccgtcaactgttgccgag
gttgcggcggaggccatcgatgcgtacttccgccccaccacaccgaatcagccggtctgg
gatccagtggcgccgctctcggagcccgcagcgtga

DBGET integrated database retrieval system