KEGG   Leishmania infantum: LINJ_33_1150Help
Entry
LINJ_33_1150      CDS       T01112                                 

Definition
putative guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lif  Leishmania infantum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LINJ_33_1150
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LINJ_33_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33:402493..403104
Genome map
AA seq 203 aa AA seqDB search
MSKPLNALVVCGPSGVGKGTLLGRLLREYPNRFAYSVSHTTRQPRQGEVNGREYHFTDRE
SILKMRDNNEFLELCDVHGNFYGTSVAAVHAVQKEGKVCVIEIDVKGAQKLFNRNDNALN
AVYFFITAPREELRKRIMKRGADDETMLQRRLETAELEYKFVDENPDFFSVLLVNDELEA
AYAALLAAIDDQLVKHNMEKLAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgttgaacgcgctggtggtctgtggaccctctggagtaggcaagggaacc
ctgctgggccgcctcctccgcgagtaccccaaccgctttgcctactcggtgtcgcacaca
acacgtcaaccgcgccagggagaggtgaatggccgcgagtaccacttcaccgaccgcgag
agcatcctcaagatgcgcgacaataacgagttcctcgagctgtgcgacgtgcacggcaac
ttctacggcacgagcgttgccgccgtgcacgctgtgcagaaagaggggaaggtgtgcgtc
atcgagattgatgtgaagggggcacagaaactgttcaaccgtaacgataatgcgctgaac
gctgtgtacttctttatcacggcccccagagaggagctgcgcaagcgtatcatgaagcgt
ggcgccgatgacgagacgatgctgcagcggcgtctagagacggccgagttagaatacaag
ttcgtcgatgagaatcccgacttcttctctgtgctgctggtaaatgatgagctagaggca
gcgtacgccgccctcttggccgccatcgacgaccagctggtgaagcacaacatggagaag
ctggctgcatag

DBGET integrated database retrieval system