KEGG   Leishmania infantum: LINJ_34_1960Help
Entry
LINJ_34_1960      CDS       T01112                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
lif  Leishmania infantum
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:lif04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34:complement(842929..844230)
Genome map
AA seq 433 aa AA seqDB search
MCRSTPSAVQLLGALFAVACLVHTSLAYPYGRSSAVTELTPASLHAFVNTHKPVVILFYA
PWCGHCKQFHPEYERFAESVKGTIRVGAIDADKNADIGQQFGVRGFPTIKYWKSGTKSVS
SSQEYQGQRTAAALQSLVVEGISSSKVMTVTTAEQMKQAARDAPKKMIGVLLSAKNKVPP
MFSVMGMSPKLKELPLVFAGSSSPEKGVAKAFGVSQLPMIGVLRYTPAEGDAEEKFEMVP
YAKKAIAYEPVARFFLDCAEKECSAGTEAPMNSVSLDEDESQHQTREAARQSSVALPVEP
VEYTPKVISLFCAPQTRKIRGQSPLCVFSLSEHVNLDNVHQYFKNDPLLFFEASQHKEEL
LQQLQADFGVQIASTGEAMTSLAGSIVVLRHSKPTTVRYALLENIDSDDDLQAALQRILN
GEVHLRSERVGAA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgtagcaccccatcagcagtgcagctccttggagcgctttttgcggtcgcgtgt
ctcgtgcacacgtcgttggcgtacccgtacggacggtcgtcggctgtcacagagctgacg
cctgcctcgctgcacgcatttgttaatacacacaagccggtggtcatcctcttttatgcg
ccgtggtgtggccactgcaagcagttccaccccgagtatgagcgatttgccgagtcggtg
aaaggcaccatccgcgttggcgcgatcgacgctgacaagaacgccgacattggacagcag
tttggcgtgcgtggctttccgacgatcaagtactggaagagcggcacaaagtccgtctcc
tcctcgcaggagtaccaaggccaacgcacagcggcggcgctgcagagtttggtggtcgag
ggaatcagctcgagcaaggtcatgacagtgacgacagcagagcagatgaagcaggccgct
cgagacgcgccaaagaagatgatcggtgtgctgctctccgcgaagaacaaggtaccgccg
atgttttcggtcatgggcatgtcgccgaagctgaaggagctgccgctggtgttcgcgggt
agcagtagccctgaaaagggtgtggcgaaggcctttggcgtctcgcaactcccaatgatc
ggcgtactgcgctacaccccggccgaaggtgatgcagaggagaagtttgagatggtgccg
tacgcgaaaaaggctatcgcctatgagcccgtcgcgcgcttcttcttggattgcgcggag
aaggagtgcagcgccggcacggaggccccaatgaactccgtgagccttgacgaggatgaa
agccagcaccagacacgagaagccgcgcggcagtcctctgtagcacttccggtagaaccg
gtcgaatacacgccaaaagtgatatcactgttttgcgcgccgcagacccgcaagattcgc
ggccagtcccccctgtgcgttttcagccttagcgagcacgtcaacctcgacaatgtgcac
cagtacttcaagaacgacccgttgctgttcttcgaggcatctcagcacaaggaagagttg
ctgcagcagctccaagccgactttggtgtgcagatagcgtctactggggaggcgatgacg
tctttggcggggtccattgtggttctgcgccattcgaagccgacaacagtgcggtacgcg
ctgctggagaatattgactccgacgacgatttacaggcagccctgcagcgcattctgaat
ggtgaggttcacctccggtcggagcgcgttggagctgcgtag

DBGET integrated database retrieval system