KEGG   Leishmania infantum: LINJ_34_2500Help
Entry
LINJ_34_2500      CDS       T01112                                 

Definition
NADPH-cytochrome p450 reductase-like protein (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     LINJ_34_2500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34:1071367..1073241
Genome map
AA seq 624 aa AA seqDB search
MTDLTILYGTQTGNAERLALRIARLALCRGFECVSCLPADDLPIAEWPHTGGPVVLICSN
ANQGDAPNTFRRSWASLLQPTAAGSMEGLQYAVFGLGDSLYLKFNHMAKMVHNRLRQLGG
TPIVMRGLGDESDATGVEEALQPWLAELWKALEKPGKCGAAAHTPAYPQEDLPFFPLFSI
APASACDEATAGALSSSANAAIAPLPYFADSVFSCEVVANRRLTSAACEQVVHHLELRAG
PDTTDAAAYDVGDALGIYCPNREELVEGLLRGLQRDGAEMVVVTPDASHGLVRQPARPFF
GRPLSLRSLLRHYFDLDAVVSQEFLWMLAHEVTGEDEGAVDVRERLYELADPSNVNDYLQ
YAHREKRNLCEVLHDFKDLHPSLELVLSFAMPMLPRYFSIASAPAMDGAGRFDLCVGLLD
WHTPLKRHRTGLCSSYLVGASPGTRLTCFVWQGSLALPATPTPLLCIATGTGVAPIRSVL
RQVAGLSTQGWDDVPVVLVFGCRREAEDYLYREEWATLKEMGALPTLRVIPAFSRDTDKK
VYVQHKLGQHARLTSSFLQPEGAGVPPGVVYVCGNAKQMPKDVQHTLEQIVEATVAEVQD
EAGAAAHIRALGRVGRYQIDSWSA
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttacgattctgtacgggacgcagactggcaacgcggagcggctagcgctg
cgcatcgctcgactggcactttgccgggggttcgagtgcgtctcgtgcctgcccgccgat
gacctgcctatcgccgagtggccgcacaccggagggcctgtcgttcttatctgctccaac
gcaaatcaaggagatgccccaaacacgtttcgccggtcgtgggcgtcgctgctacaaccc
accgccgctggcagcatggagggcctgcagtacgctgtcttcggcttgggcgactctctg
tacctgaagttcaaccacatggccaagatggtgcacaaccgtctccggcagctgggcggc
acaccgattgtgatgcgcgggctgggggatgagagcgacgcgacgggcgtggaggaggca
ttgcagccctggctcgcggagctgtggaaagcacttgagaaaccgggcaagtgcggtgcc
gccgcacatacgccggcctacccgcaggaggaccttcctttctttcctcttttcagcatt
gcacccgcctctgcgtgcgacgaggcgacagctggcgcgctgtcttcttccgctaacgcc
gccatcgcgccactgccgtattttgccgactctgtgttctcctgcgaggtggtggcgaac
aggcgcctcacgtctgctgcgtgcgagcaggtggtccatcacctggagcttcgcgctggc
cctgacaccacggacgccgcggcgtacgatgtcggcgatgcgctcggcatctactgcccg
aatcgcgaagagctagtagaggggctgctgcgcggactgcagcgagacggggcagagatg
gtggtggtgaccccagacgcctcgcatggactcgtccgtcagcccgcccgccccttcttt
gggcggcctctctcgctacgttcgttgcttcgtcactactttgaccttgacgctgtggtg
tcgcaagagttcttgtggatgctcgcgcatgaggtgactggggaggacgagggcgcggtc
gacgtgcgggaacgcctctacgagctggcggatccgtccaacgtgaacgattaccttcag
tatgcgcaccgtgagaagcgcaacctatgcgaggtcctgcacgatttcaaggatcttcat
ccatctctggagttggtcttgtcgtttgcgatgccgatgctgccgcgctacttctccatc
gcctccgcgccagcaatggacggcgcaggtcgttttgacctctgcgtaggactgctggac
tggcacacgccactcaagcgccaccgcaccgggctctgcagctcctacctggtgggggcg
tcccccgggacacggctgacgtgttttgtctggcagggctcccttgcacttcctgctaca
ccgacgccgctgctgtgcatcgcgacggggacgggtgttgcaccaattcgcagtgttctg
cggcaggtcgccggcctttcgacgcagggctgggatgatgtgccggtggtgcttgtattt
ggatgccgacgtgaggcggaggattacctttaccgcgaggagtgggcgacgctgaaggag
atgggtgcattgcccaccctccgagttatcccggccttctcgcgagacaccgacaagaag
gtttacgtgcagcacaagctcggccagcacgcaaggctgacgtcgtcctttttgcagccc
gagggcgccggtgtcccgccgggtgtggtgtacgtgtgtggaaacgcgaagcagatgccg
aaggacgtgcagcacaccctagagcagattgtcgaggcgaccgtggcagaggtgcaggac
gaagccggggcggccgcgcacatcagggcccttggccgcgtgggtcgctatcagatcgac
tcgtggtcggcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system