KEGG   Leishmania infantum: LINJ_34_3160Help
Entry
LINJ_34_3160      CDS       T01112                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
lif  Leishmania infantum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LINJ_34_3160
Enzymes [BR:lif01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     LINJ_34_3160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34:1308650..1309555
Genome map
AA seq 301 aa AA seqDB search
MVAFTPDSRGRNCVTIHSEDGSSVTVYEQGAHVSSWKTKDGKEHLYLSPTAIFADRTALR
GGVPLIFPQFGAYGPLQPSHGFARIRSWNIEDAQSGRASFSLRVPLCELLPEDSSLTDSP
QSAVNLLYTICFSNTELKLRMKVTNTSEEQSAPFQFAFHTYFAVSDVSKTVVSGVNRSPF
VDNCKARGNPNTQPSPPEQLWIISGEHDRVYPDQACAIVLQDLGTKTTLQISSPNLSDVC
LWNPGESKCAAMKDMPPDGYKHFVCVEHGKMLKKVVVPPCSSWTGTQEIAIIAESPRESN
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggttgccttcactcccgactcccgcgggcgcaactgcgtcactatccacagcgaagat
ggctccagcgttaccgtctatgagcaaggcgcgcacgtcagtagctggaagaccaaggat
ggaaaagagcatctgtacctcagccccactgccatcttcgctgaccgcaccgccctgcgt
ggtggcgtgccgctgatcttcccgcagttcggggcttacggcccgctgcagccgtcgcac
ggcttcgcgcgcattcgttcgtggaacatcgaggatgcccagagcggcagggcgagcttt
tcgttgcgcgtgcccctgtgcgagctgctgccggaggattcttctctcaccgattccccg
cagagcgccgtcaacctgctgtacacgatttgcttcagcaacaccgagctgaagctgcgt
atgaaggtcacgaacacaagcgaggaacagtcagcaccgtttcagtttgccttccacacg
tatttcgcagtgtccgacgtttcgaagacggtagtcagcggcgtcaaccgctctcctttc
gtcgacaactgcaaggcgcgcggcaacccgaacacacagccgagcccgccggagcaactg
tggattattagtggcgagcacgaccgcgtttaccccgaccaagcgtgcgccatcgtcctc
caggacctgggcacgaagaccacgcttcaaatctccagtcctaacctaagcgacgtgtgc
ctctggaaccctggtgagtccaagtgcgctgcgatgaaggacatgccaccggatggctac
aagcactttgtgtgtgtggagcacggcaaaatgctgaaaaaggtggtggtgccgccgtgc
tcgagctggaccggcacgcaggagatcgcaatcatagctgaaagtcctcgtgagtcgaac
atatag

DBGET integrated database retrieval system