KEGG   Leishmania infantum: LINJ_34_3890Help
Entry
LINJ_34_3890      CDS       T01112                                 

Definition
putative cysteine peptidase, Clan CA, family C19 (EC:3.1.2.15)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LINJ_34_3890
Peptidases [BR:lif01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LINJ_34_3890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34:1553353..1556073
Genome map
AA seq 906 aa AA seqDB search
MRSGYVGIYNQGSTCYLNSVIQALYHLPAFRTQIYNLPNVQKDSVALALRDVFAQLEVRN
RNTTTTELTKAFGWSAQEAAVQHDVHELMQQLFDSLETTLKETPKKNMIRDMFGGLMIYR
SRAIDGAEYLSDRLEDFYDVELVVQNKANIEESLREFSSGERIEGVCVEVVPGADATPHT
IERSQHFLDCPKVLLVHPNRVAFDMETYELVTLRNVWSFDFNLSLASYVVDDASLKLDKE
SQEKWKKLSHRTHLGANYSLRSILTHAGDATIGHYYVYVNFDGEWVRFNDEVVEPATEED
VRKSAFGGQSIQSRYRLFDNERASLLIYVNDDVKEELLNETPPPSAIVEVGRHIEEERAR
KEETHKVSYYLCDKFVVDVLDGVHGASDKLQRHMSVRLSPGQDEMTAIITTAAKELRVAP
EQIRIFCRDRHGLSPWCAVESMCNSYDSYYYPPIFIDIAPPLAEEDAASATIAAAAAEPF
LAFLRNVESPHDRDVPVTIVRSIPELQARVPRDAVVYESRGGPQYLNAITATNQLVCGAN
LLYTHQRSSNDAVRGYLQQRQLVCTKVYLYDDYTAELTELFEINIVESTPYTTLQAGLYK
MMTESKRGLPIPPSHNHLAFFKGNDRCNYAFAMPMAASLTIQWNTYNHTLRDVWGSVQHE
HKIVMTILPMPLEKIDLTVLVTFNGGYNNLPHVYVPVEGGSVTFRELLELMVQQLGSRLR
AGAAAGYEQQLTGQARLLRLLRVRRGELVEVVEDLDTPIDLEAREDIVLDKLCPALPGYE
LVNVLFCRRRSGEYYFGLPTNICINSSLEEQGDVLLRRIVKKLGYPDQEEAMKKWILCVM
NVKSRKTRTASKKEVLADLVKEVGGAPFVFVVDRPQCLLLDGIEEEEHRPESIVIKSASK
TDLSAA
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcggggtacgttgggatctacaatcaaggtagcacgtgctacctgaactcggtc
atacaggcgttgtaccacctacccgccttccgtacgcaaatttataacctcccgaatgtg
caaaaagactccgtcgcactcgctctgcgggacgtgtttgcgcagctggaggtgcgcaac
cgcaacaccaccacgacggagctgaccaaggcttttggctggtcggcgcaggaggcggca
gtgcagcatgacgttcatgagttgatgcagcagctctttgacagcctcgaaacgacgctg
aaggagacgccgaagaagaacatgatccgtgacatgtttggcggcttgatgatctaccgg
tctcgtgccatagacggcgccgaatacctctctgaccgcctcgaggacttctacgacgtg
gagctggtagtgcagaacaaagcaaacatcgaggagtcactgcgggagttctcatccgga
gagcggatcgaaggtgtctgtgtggaggtggtgcctggtgcggacgcgacgccgcacacg
attgagcgcagtcagcacttcctcgactgccccaaggtgctcttggtacacccgaaccgc
gtggcgtttgacatggaaacatacgagctggtcacgctacgtaatgtgtggagttttgat
ttcaacttatcgctggcgagctacgttgtcgatgacgcctcgctgaagctcgacaaggag
agtcaggaaaaatggaagaagctcagtcaccgcacccacctcggcgcgaactacagcctg
cgctccatcctcacgcacgccggcgatgccaccatcgggcactactatgtgtacgtcaac
ttcgacggggagtgggtgcgcttcaacgacgaggtggtcgagccggcaacggaggaagat
gtgcgcaagtccgcgtttggcgggcagtcgattcagtcgcgctaccgtctcttcgacaac
gagcgcgcgtcgctgcttatctacgtgaacgacgatgtcaaggaggaattgttgaacgag
acgccgccaccgagcgcgatcgtggaggtgggccgccacattgaggaagagcgcgctagg
aaggaggagacgcacaaggtgagctactacctatgcgacaagttcgtggtggacgtgctc
gacggcgtgcacggcgcctccgacaagctgcagcgtcacatgtctgtgcgcctctcgccc
ggtcaagatgagatgaccgccatcatcactactgcagcgaaggagctgcgcgtagcgcca
gagcagattcgcatcttctgccgcgaccgtcacggcctctccccatggtgtgctgttgag
tcgatgtgcaactcgtacgactcatactattatccgcccatttttatcgacatcgcgccg
ccgctcgcggaagaggatgcggcgtccgccacgattgccgctgccgccgccgagccgttc
ctcgcgttcctccgtaatgtcgaatcgccgcacgaccgcgacgtccccgtcacgatcgtc
cgctccatcccggagctgcaagcgcgagtgccgcgcgatgcggtcgtgtacgaaagccgc
ggcggcccgcagtacctgaacgccatcacagcgacgaaccaactcgtgtgcggcgcaaac
ttactttatacgcaccagcgctcctccaacgacgcggtgcgcgggtaccttcagcagcgc
cagctcgtctgcacaaaggtctacctgtacgacgactacaccgccgagttgacggagctc
tttgaaataaatattgtcgaatccacgccctacaccacgctgcaggccgggctgtacaag
atgatgacagagtcgaagaggggcctgccgatccctccctcccacaaccacctcgcgttc
ttcaagggaaacgacagatgcaactacgccttcgcaatgcccatggcggcgtcgctcacg
attcagtggaacacgtacaaccacaccctccgagatgtgtggggtagcgtgcagcacgag
cacaaaattgtcatgacaattcttccaatgccgctcgaaaagatcgacttgacggtgctg
gtgacgttcaacggaggatacaataacttgccgcacgtgtacgtcccagtggagggtggc
agcgttacttttcgcgaacttcttgagttgatggtgcagcagttgggcagtcgtcttcgg
gcaggcgctgccgcggggtacgagcagcagctcaccgggcaggcacggctgctgcggctg
ctgcgggtccgacgaggcgagctggttgaggtggtggaggacctggacactccgattgat
ctcgaggcacgcgaggacattgtcctggacaagctgtgcccggcactgcccgggtacgag
ctcgtcaacgtgctcttctgccgccgccgctcaggagagtactactttggtctaccgaca
aacatctgcatcaactcgtctctcgaggagcagggcgatgtgcttcttcgacgcatcgta
aagaagctcgggtaccctgatcaggaggaggcaatgaagaagtggatactttgtgtaatg
aacgtcaagtcccgcaagacgcgcactgccagcaagaaggaggtgctggcagatctcgtc
aaggaggtcggcggcgcaccgttcgtgttcgttgtcgaccgtccccagtgcttgctcctc
gacggcattgaagaggaggagcaccggccagagtccatcgttatcaagtctgcctcgaag
acagacctctccgcggcttag

DBGET integrated database retrieval system