KEGG   Leishmania infantum: LINJ_34_4160Help
Entry
LINJ_34_4160      CDS       T01112                                 

Gene name
TOR2
Definition
phosphatidylinositol 3-kinase (tor2)-like protein (EC:2.7.1.137)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
lif  Leishmania infantum
Brite
Protein kinases [BR:lif01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   LINJ_34_4160 (TOR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34:1639554..1646870
Genome map
AA seq 2438 aa AA seqDB search
MSSVDSDKLATSIRALAGSRDERIAFVTEGVKQAKELQGKSVQEYEMVVSSLLMCLESFE
VVHGTSLDVLCELTVLDILLNLDLSVIQLSQCNSYLRLCLMAVNEIPVAVAAAKTFAQTL
SYSMTTDFVRTQIGETLEWISLSDAKSQPRRICGILVLTEVALRIPMVILPRLSEVFDRA
WDCLVVHDEEVRSRALCLFTLCAKLLVNRPAAIRAETCDALMSHLKGNLASKSKGKRIAG
LLAFEPIVINSIGTSNIRYEDLSNLLVPYIMGGGANVNADTRELLFRCLVVLCRFSAPQF
VAHQLKESVRFALDSINRNIQRNTAFEMLSEIIPIVGKTEFAPFVDDTCEVIKTIFEKSP
SPCWKALQCFSIICKECRPSKMETYVESCIENVFVWGLSAELIECMRAIIESSSVQYRAK
LEESLLDMISVTLCGLPFRQQIDAPRVSESSTDVSASEYQISVALNALKQFGFSNSELMG
DFLRVSVLPFIDNNSVAVRNAAVYTIVKLLIPPGEKGDLSIARRMCVNTVITRMLVVGLS
DPNPVVRQTILSAFTEDFYPYLSEQQYLFRFYSALGDESINCRVAATEQLCQMIRYDPSH
ILPALREEMVVILHFITSTFNMDTVQNGFRLLAAIATRAPQLVVNFTEGICEALAPYFST
LSSRSGILLSFLHCCTAVAAALRKFGSTPFSSKREIALVCELLETLPADRSYHIIRLSCL
RFLSATLAPLMEGASPYVLYPRLFQQLCTVLHRTEESVDIRLEALRCIGVIGALDSHVFQ
SFNLNEKEKASGMSAVVVDRVTHVKCCRIVLCAVAALLDPESKRSAGAREGLLRTGVQTM
LNIFEHVPCSKSEIGLVIGPLARVIRQLPGGRLFATVLFEFCNIIRYGGAVVLNDLNEIY
RVFDNVWEFQVNYRFLAVRMLSFVANFEASGNLHYGQQHSRILPQLFDTLNRADLRADLK
YAVLEYIVRHVDSLQPCTEAAVDNLLGAIQNPANPLDFVNHCVVTLKEICVKLYVDELVG
AIVRCLLACLSVDLARKTRGRDNIALCNNIMGVFCVLIEELQGNFLKYSTYIIQALKNYR
ITNTEFGVMNNRVATGLRCARSAMSIQQQNAEVAALLKTCESVVMKSMSRMGEVWSYANL
NDDNANAGAAEERTMPINEQRLINPMKVVPLTKEEWVKWSDQFAITLLQESPFQVFRCTA
VPIGINAAPLVEKSTQFVQDTLQIAFRSMWNYASSALQTAITDFFRQSFRQAMMSTTVPA
EVVTMLLGIVEYMDHVGEALFISYNDLSECAWNRGMLAKALFWREAAYRDDPVGTVESLI
SLYSELHMVDSSVGILNMTSEEQRRSLLQTSLVKLARYTEALQLTQQELELEAAPLEESS
TENLSKGCGYKNGSRGWSRMLHYTSNSDLTPSSSKAEESCRDRRVEVNARLMLCLSELGE
YDKVLEQWGSMLHNYKDRVTDTDEMHVLFFVSQYAADASIRLQSWDTLEHVLDWLPPDMV
LYHVSKAALEVVRGNYDAALVSVTNGRKVLLEDLTSLLHESYARAYEGLVVAQQLTEVEE
VIIAKQTQKALSSAAHIPHLCHIWEQRIRMMHATVPTWKQVLGIRGLLISPHEDVKTRIQ
FTKLCRQEKARQLEKFTLAELLGFANPTLEQLTSRNVNPRVVMQYISYLSETNALGPGSA
FGTESDLIKKMIDVHTKAENSAVLARAYTRLGSKVDLIESVQCFKTAIMYDPQWFLAWRK
WAEANAQLLQTDKGEETCRNAIEGFIRSIQLGTSDSTLIQDVLKLLTLWSSHCDSDHNLK
ELRERVFDVPSRVWHLVVPQLVARLDTGSDDSCRLVADVLTNVGYDYPHTLVYPLNLCTM
SDSERRNRYSNEVLGKLQERYPVIVLQGRLMIDELIRVSALIYEQWYDKLEAAATAFFGR
RSTDEMIRTLLPIHETLTRVPETVVESEFLSKYSKRLTEARDWLRSYSSTRYTGDIQSAW
KLYHSVYCNIDKQIKSSDTLQLQFCSPKLFEARNLSIGIPDARPVREESVAKVNRFQKDI
IVIASKQRPKRIGIITAEGRLQKFLLKGREDLRLDERVMQLFSLVNILMQSDSRTSKNLG
FQIQRYSVTPLKDNVGIIGWVDGCDTLHEVVKHFRERKSIPVELEMRMLDQIITFDNSKA
YDYLTIMSKVEVLEFLSDHTSGQDIRKAMWNTSPNCEVWYDRRRMYTTSLANMSIVGYIL
GLGDRHPNNIMLQRASGLVVHIDFGDCFEVAMTRDKFPEKVPFRLTRMLRSALDVSGVDG
AFRACSETAMCVLREGSHSVLALLEAFIQDPLISWRLINRHGQEPESSNDHKTIEQQVNI
ANMRNATSTAGAESMCDSVGKRDSGTFSVAKHLCGEEVDVVHQGVFIVKRLSSKLKGQDF
ISAGTEPLDPRTQVGQLIEEATDVTNVAQSWSGWYPFW
NT seq 7317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggtcgactcggataaactcgcgacctccatccgcgcactagccggcagtcgc
gacgagcgtatcgcctttgtgacggagggcgtgaagcaggcaaaggagttgcagggcaaa
agcgtgcaggagtatgagatggtggtgtcgtcgctgcttatgtgtctggagagctttgag
gtggtgcacggcacgtcgcttgatgtgctctgcgaactcactgtcctggacattctgcta
aacctagacttgtctgtcatccagctgtcgcagtgtaacagctacttgcggctttgcctc
atggcggtgaatgagattcccgtcgctgtggcagctgcaaagacgttcgcgcagacgctt
agctacagcatgacgacggactttgtgcgcactcaaatcggagagacactcgagtggatt
tcgctctccgacgccaagtcgcagcctcgtcgcatttgtggcatcttggtgctcacggag
gtagcgttgcgcattccaatggtaattctgccgcggctctccgaggtgttcgacagggct
tgggactgcttggtggtccacgacgaggaggtccgctcacgcgctctgtgtctcttcacg
ctatgcgcaaagctgctggtcaaccgccctgccgccattcgtgctgaaacctgcgacgca
ttgatgtcacacctgaagggtaacctcgcctctaaatcgaagggcaaacgcattgctggc
ctccttgcattcgagcccatcgtcatcaactcgatcggcaccagcaacatacgctacgaa
gacctctccaaccttctagtcccctacattatggggggcggcgccaacgtcaacgccgac
acgcgcgagctcctgttccgctgcctggttgtcctctgccgcttcagtgcaccacagttt
gtcgcgcaccagctcaaggagagcgtgcgcttcgcgctggattccatcaaccgcaacatt
cagcggaacaccgccttcgagatgctctctgagatcattccgattgtaggcaagacagag
tttgcgcccttcgtagacgacacgtgtgaagtaatcaagaccatttttgagaagtctccg
agcccgtgctggaaggcgctgcagtgtttctccatcatctgcaaagagtgccggccatcc
aagatggagacatacgtggagtcgtgcatcgagaacgtgtttgtgtggggcctttccgcg
gagctgattgagtgcatgcgcgccatcatcgagtcgtcgagcgtgcagtaccgagcaaag
ctggaggagtcgctgcttgacatgatctccgtcacactatgcggtctcccatttcgacag
cagatcgacgcgccgcgcgtcagtgagagctctacggatgtgagcgcctccgagtatcag
atctccgttgccctgaacgccctcaagcagttcggcttctccaactcggagctcatgggc
gactttctgcgcgtctcggtgctgccttttatcgacaacaacagcgtcgcggtgcgcaac
gcagctgtctatacgatcgtcaagcttctcatcccccctggcgagaaaggcgacctcagt
atcgcacgtcgcatgtgcgtcaacaccgtcatcacgcgcatgctggtcgttgggttgtca
gaccccaatcctgtggtgcgtcagaccattctgagtgcctttacagaggacttttatcca
taccttagcgagcagcagtatctctttcgcttctactctgccctgggtgacgaatccatc
aactgtcgcgtggcggcgacggagcagctgtgccagatgatccgctatgacccatcgcac
attctgcctgcgctacgagaggagatggttgtcattctacacttcattacgtctaccttc
aatatggacaccgtccaaaacgggttccgcctcctcgccgcgatcgccactcgcgcgccg
caactcgtagtgaactttacggaaggcatctgcgaggctctggcgccgtactttagcact
ctctcctcccgctccggcattctcctgtcgttcttgcactgctgcacagccgtcgcggcg
gcgctccggaagtttggtagcacccccttctcctccaaacgtgaaatcgctcttgtgtgt
gagctgctggaaaccttgccggcggaccggtcgtatcacatcatccggctgtcctgtctc
cgcttcctctcggcaacccttgcgccgctcatggaaggtgcctcgccttacgtgctgtat
cctcggctctttcaacaactctgcacggtgctgcacagaacagaggagagcgtcgacatt
cgccttgaagcgctgcggtgcattggcgtgatcggtgcgctggactcgcacgtgttccag
tcgttcaatctcaacgagaaggagaaggcgtctgggatgagcgcggtggtggtggacagg
gtgacacacgtgaagtgctgccgtattgtgctctgcgctgtggcagcgctgcttgacccg
gagagcaagcgctccgccggcgcgcgcgaagggctcctgcgcacgggtgtgcagacgatg
ctgaacatctttgagcatgttccgtgctccaagagtgaaatcggtctcgtgatcgggccg
ctggcccgcgtcatccggcagctgcctggcggccgcctctttgcgaccgtgctcttcgag
ttctgcaacatcattcgctacggcggtgcggtggtgctcaacgatttgaatgagatttac
cgcgtatttgacaacgtatgggagttccaggtcaactaccgatttctggccgtgcgcatg
ctctcgtttgtcgccaacttcgaagcctccggcaatttgcactacggccagcagcactcg
cgcatcctgccgcaactcttcgacacgctcaaccgtgctgacctgcgcgccgacctcaag
tacgccgtacttgagtacattgtgcgtcatgtcgactccctgcagccgtgcacggaggcg
gcggtggataacctgctcggcgccatacagaacccggcaaatccgcttgactttgtgaac
cactgtgtggtgacgcttaaggagatctgcgtcaagctgtatgtcgatgagctcgtcggc
gctattgttcgatgtctgctggcatgcctctccgtcgaccttgcacgcaagacacgcgga
cgcgataatattgctctctgcaacaacatcatgggggtcttctgcgtcctgatcgaggag
ctgcagggcaattttctcaagtactcaacgtacattattcaggccttgaagaactaccgc
atcacaaacacggagtttggcgtaatgaacaaccgcgtcgccaccggcctccgctgtgca
cgcagcgcaatgtcgatccagcaacaaaacgcggaggtggccgcgctactgaaaacatgc
gaatctgtcgtgatgaagagcatgtcgcgcatgggcgaggtctggagctacgcgaacctc
aacgacgacaacgcaaatgcaggggccgccgaggagcgcaccatgcccatcaacgaacag
cgtctcatcaatccaatgaaggttgttcccctgacgaaggaggagtgggtcaagtggtcg
gaccagttcgccatcacgctgctgcaagagtcgccgtttcaggtcttccgctgcacggcg
gtgcccatcggcatcaacgcagccccgctggtcgagaaatcgacgcagtttgtgcaagac
acactccaaatcgcctttcgatccatgtggaattacgcgagctcggcgctgcaaaccgct
atcacagactttttccgtcagtcgtttcgtcaggcgatgatgtcgaccactgtcccggcg
gaggtggtgacgatgttgcttggtatcgtggagtacatggaccacgttggtgaggccttg
ttcatctcgtacaatgacctctccgagtgtgcgtggaaccgaggaatgttggccaaggcg
ctcttttggcgcgaggccgcctaccgcgacgaccctgtcggcaccgtcgagtcgctcatc
tctctctacagtgagctacacatggtggactcctccgttggaatcttgaacatgacgagc
gaggagcagcggcgcagcctgctgcagacaagcctggtcaagctcgcgcgctacacggag
gcgctccagctgacgcagcaggagctggaactggaagctgccccgttggaggagagtagc
accgagaacttatccaagggctgcgggtacaagaacggcagccgcggctggtctcgcatg
ctgcactacacgtccaacagcgacctcaccccgtcctcctcaaaggcggaggagagctgt
cgcgaccgccgcgttgaggtgaacgcgcgactgatgttgtgcctgagcgagcttggcgag
tacgacaaggttctggaacagtggggcagcatgctccacaactacaaggaccgcgtgaca
gatacagacgagatgcacgtgctgttttttgtctcgcagtacgccgcagacgcgtcgatc
cggctgcagtcgtgggacacgctggagcacgtcctggactggttgccgccggacatggtt
ctctaccacgtgtcaaaggcggctctggaggtggtgcgcggcaactacgacgccgcgctc
gtctccgtgacgaacgggcgcaaggtgctgctggaggatctgacaagcctgcttcacgag
tcgtacgcgcgcgcctacgaggggctcgtggttgcgcagcagctgacggaggtggaggag
gtcatcatagcgaagcagacgcagaaggcgctcagctccgctgcccacataccgcatctc
tgccatatctgggagcagcgcattcgaatgatgcatgcgacggtgccgacatggaagcag
gtgctggggatccgtggcctgctcatctcgccccatgaggacgtgaagacgcgcatccag
ttcaccaagctctgtcggcaggagaaggcgcggcagctagagaagtttacgctggccgag
ctcctcgggttcgccaacccgaccctggagcaactcacgagccgcaatgtgaacccacgc
gtggtgatgcagtacatctcatacctctccgaaaccaacgcacttggccctggcagcgcc
ttcggaaccgagagcgaccttatcaagaagatgattgatgtgcacaccaaggcagaaaac
tcggcagtattggcgcgggcctacacgcgtctcggcagcaaggtcgatctcatcgagtcg
gtgcaatgcttcaagactgccatcatgtacgatccacagtggtttctggcatggcgtaag
tgggccgaagcgaacgcgcagctgctccagacagacaagggcgaagaaacgtgccgcaac
gctatcgagggctttatccgaagcattcagcttgggacgtccgactcgacgctcattcaa
gacgtgctcaagctgctgacgctctggtcgagccactgcgactctgatcacaacttaaag
gagctgcgcgagcgtgtcttcgatgtgccgtcgcgcgtgtggcaccttgtggtaccacag
ctggtcgcccggctcgacaccggctccgacgacagctgccggcttgtggcggatgtcctg
acgaacgtgggctacgactacccccacaccttggtgtacccgctgaacctgtgcaccatg
tctgattcggagcggcgtaacaggtactccaatgaggtgctgggcaagctgcaggagcgg
tatccggtgattgtgctgcagggtcgtctcatgattgacgaacttatccgcgtctcggcc
ctcatctacgagcagtggtatgacaagctggaggcggcggcgacggccttctttggccgt
cgcagcaccgacgagatgatacgcacgctgctgccgattcacgagacgttgacacgggtg
ccggagacggtggtggaatcggagtttctgtccaagtacagcaagcgtctgaccgaggcc
cgggattggctgcggtcgtactcgtcaacgcgctacaccggcgacattcaatctgcatgg
aagctgtaccacagcgtgtactgcaacatcgacaaacagatcaaatcgagcgacacccta
cagctgcagttctgcagtccgaagctgtttgaggcgcgcaacctctccatcgggatcccc
gacgcgcggcctgttcgcgaggagtcggttgcgaaggtgaaccgctttcagaaagacatc
atcgtcatcgcgagcaagcagcggccgaagcggatcggcatcatcacggcggaggggagg
ttgcagaagttcctgctcaaagggcgcgaggatctccgcctggacgagcgcgtcatgcag
ctcttctcgctagtcaacatcctcatgcagtccgactcgaggacgagcaagaacttaggc
ttccagatccagcgctactccgtcacgccgctaaaagacaacgtcggcatcattggctgg
gtcgacggctgcgacacgctgcacgaggtcgtcaagcactttcgcgaacgcaaatcgatc
ccggtggaactggagatgcgcatgctggaccagatcatcacctttgacaactccaaggcg
tacgactacctgaccatcatgtcgaaagtagaggtgttggagttcctctccgatcacacc
tccgggcaggacattcgcaaggccatgtggaacacgtcgccgaactgcgaggtctggtac
gatcggcgccgcatgtacacaacgtccttggcgaacatgagcatcgtaggctacatcctc
ggcctcggcgaccgccacccaaacaacatcatgctgcagcgcgcgtctggattggtggtg
cacatcgactttggtgactgctttgaggttgccatgacgcgcgacaagttccccgaaaag
gtaccgttccgattgacacgtatgctgcgcagcgcgctcgacgtgtcgggtgtcgacggg
gcgtttcgtgcctgctcggagacggcgatgtgcgtgctgcgcgagggcagccacagcgtg
ctggccctcctcgaggcattcattcaagacccgcttatttcgtggcgcctcatcaacaga
catgggcaggagcccgagtcgtcgaacgatcacaagactatcgaacagcaggtgaacatt
gccaacatgcgcaacgccacatcgacggcgggagcggaatccatgtgtgactctgtagga
aagcgcgatagcggtacctttagtgtcgcgaagcacttgtgtggggaggaggtggatgtg
gtgcatcagggtgtgttcatcgtcaagcgcctcagctccaagctcaaagggcaggacttt
atctcggctggcacggagcccctcgacccacgcacgcaggtagggcagctcatcgaagaa
gccacagacgtcaccaacgtggcacagtcctggtcgggatggtacccgttctggtag

DBGET integrated database retrieval system