KEGG   Leishmania infantum: LINJ_35_3130Help
Entry
LINJ_35_3130      CDS       T01112                                 

Definition
putative glycerol kinase, glycosomal (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lif  Leishmania infantum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LINJ_35_3130
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LINJ_35_3130
Exosome [BR:lif04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LINJ_35_3130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35:complement(1252855..1254393)
Genome map
AA seq 512 aa AA seqDB search
MPYVASIDQGTTSSRCIIFDEKFTVLSAHQLFHKQITPRPGWLEHDPEEIYSNCCLCLAE
ALKKLRSKDPKFDKVSAIGITNQRETGVAWDRKTGKPLCNAIVWSDARTYELSNRIAKEC
GGGDSNFAASITGLPVSTYFTAFKFRWMLENVPAVAAARKSGSLLLGTIETWLLWKLSEG
KVFVTDVSNASRTFLMNLRTQQWCDKLCQELDIPRATLPEIRSNSEHYCNVSANDHGIRD
ALGMPTPVTGCIGDQQSALFGHIGLNKGDAKNTYGTGCFVLMNVGTEPQFSKHGLLGTIA
YKLGTEPTKFALEGSIAGAGATVEWMRSNLGFFDHPMEMESIARKVGSTDGVVFVPAFGG
LLAPYWDPTARGTLVGMTYKTNKSHIIRAALEAISMQVSAVMLAMKEDSGVEINCLRVDG
GLTRSRLLMEMQADILGVNLYVPHLTETTALGAALCAGLAVGVWKSIEEVQKTAKEHLSG
ETVTPITADEQVRKARLEAWNAAVKLSQWAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacgtcgcgtctattgaccagggcaccacctctagtcggtgcatcatcttcgac
gaaaaattcaccgtcctctcagcccaccagctcttccataaacagatcacgccgcgtcct
gggtggctggagcacgatccggaagagatttacagcaactgttgcctctgccttgcagag
gcgctgaagaagctgcgctcaaaagaccccaagttcgacaaagtgtccgcgataggtatc
acgaaccagcgtgagacaggtgtcgcctgggaccgcaagaccgggaagccgctgtgcaac
gccattgtgtggagcgacgcccgtacctatgaattgagcaaccgcatcgcaaaggaatgt
ggtggcggcgacagcaactttgccgccagtattactggcttgcccgtaagcacctacttc
accgccttcaagttccgctggatgctggaaaatgtcccagccgtcgccgccgcgcgcaag
agcggctcgctactcctcggcactatcgagacgtggctgctgtggaagctgagcgagggc
aaggtgtttgtgacggatgtgtcaaacgccagccgcaccttcctaatgaacctgaggacg
caacagtggtgcgacaagctctgccaggagctcgacattccacgcgcgacactgccggag
attcgcagcaacagcgagcactactgcaatgtctcggccaacgatcacggcatccgcgat
gctctcggcatgccgacgcccgtgacgggctgcattggtgaccagcagagtgccctgttc
ggtcacataggcctgaacaagggtgatgccaagaacacctacggcacgggctgctttgtg
ctcatgaacgtgggcacggagccgcagttctcgaagcacggtctgctcggcaccattgcg
tacaaactgggtaccgagccgaccaaatttgccctggagggctccattgcgggcgctggc
gccacagtggaatggatgcggtccaaccttggcttcttcgaccaccccatggagatggag
agcatcgcccgcaaagtgggcagcacagacggagtcgtgtttgtgcctgccttcggcggt
cttctcgccccgtactgggacccgacggctcgtggcacccttgtgggcatgacgtacaaa
acgaataagtcgcacataatccgcgccgccctcgaggccatctccatgcaggtgagcgca
gtgatgcttgctatgaaagaggatagcggcgttgagatcaactgcctgcgcgtcgacggt
gggctcacgcgtagtcgcctgctcatggagatgcaggccgacatcctgggtgtgaacctt
tacgtgccgcatctcaccgagacgaccgcccttggcgcagccctttgcgctggcctggcc
gtcggcgtctggaagtctatcgaggaggtacagaagacggccaaggagcaccttagcggt
gagactgtgacccccatcacggcagatgaacaagtgcgcaaggctcgcctggaggcctgg
aacgccgccgtgaagctgtcgcaatgggcgaagctgtaa

DBGET integrated database retrieval system