KEGG   Leishmania infantum: LINJ_35_4060Help
Entry
LINJ_35_4060      CDS       T01112                                 

Definition
protein kinase A catalytic subunit isoform 1
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     LINJ_35_4060
Protein kinases [BR:lif01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   LINJ_35_4060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35:1585786..1586901
Genome map
AA seq 371 aa AA seqDB search
MSSAAKDSCPAESSGHLNNEKAQLSKIPSSHPDPSKVAVASKVKAAYSFERPDTSSWKLS
DFELKNTLGTGSFGRVRIAHRKGTEEYYAIKCLRKREIIKMKQQQHVAQEKGILMELCHP
FIVNMMCSFQDEKKVYFVLEFVMGGEMFTHLRTAGRFPNDVAKFYHAELVLAFEYLHSLD
VIYRDLKPENLLLDNKGHAKVTDFGFAKKVPDRTFTLCGTPEYLAPEVIQSKGHGKAVDW
WTMGVLLYEFIAGYPPFYDDTPFRIYEKILAGRLKFPNWFDGRARDLVKGLLQTDHTKRL
GTLKGGPADVKSHPYFHGANWDKLYARYYPAPIPVRVKSPGDTSNFEKYPDSPVDRTPAL
TSAQQAEFNGF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgctgccaaggacagctgtccggcggagtcgtcgggccacctcaacaacgag
aaggcgcagttgtcgaagattccctccagtcatcccgacccctcgaaggtggctgtcgcg
tcaaaagtaaaggccgcctattcctttgagaggccggacacctccagctggaaactctcg
gatttcgaactgaagaacacgctcggcaccggctccttcggccgcgtgcgcatcgcccac
cgcaagggcacggaggagtactacgcgatcaagtgcctgagaaagcgcgagatcatcaag
atgaagcagcagcagcacgttgcgcaggaaaaggggatcctaatggagctgtgccacccg
ttcatcgtgaacatgatgtgctccttccaggacgagaagaaggtgtactttgtgctggag
ttcgtcatgggcggcgagatgttcacacacctgcgcactgccgggcggttcccgaatgac
gttgcgaagttctaccacgcggagctggtgcttgcgttcgagtatctgcactcgctggac
gtgatctaccgcgatctgaagccggagaatcttctgctggacaacaaggggcacgcgaag
gtgacggactttgggtttgcgaagaaggtgccagaccggacgttcacgctgtgcgggaca
ccggaatatcttgcgccggaggtgatccagagcaagggccacgggaaggcggtggactgg
tggacgatgggcgtgctgctgtacgaattcattgccggatacccgccgttctacgacgac
acgccgttccgaatttacgagaagatccttgctgggcggctgaagttcccgaactggttc
gacggccgtgcgcgcgacctcgtgaaggggctgctgcagacagaccatacgaagcgcctg
gggacgctgaaaggcgggccggcggacgtgaagagccacccgtacttccacggtgcgaac
tgggacaagctgtatgcacgctactaccccgcgccgatccctgtgcgggtgaagagccct
ggcgacacgagcaacttcgagaagtacccggacagcccggtcgaccgcacgcctgcgctg
acgtcggcgcagcaggcggaattcaatggcttttag

DBGET integrated database retrieval system