KEGG   Leishmania infantum: LINJ_36_0780Help
Entry
LINJ_36_0780      CDS       T01112                                 

Definition
putative mitogen-activated protein kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LINJ_36_0780
Protein kinases [BR:lif01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LINJ_36_0780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:213868..215238
Genome map
AA seq 456 aa AA seqDB search
MSAEIESHILKKYEIQAQLGQGAYGIVWRALERKHNRVVALKKIYDAFQNSTDAQRTFRE
IMFLHRLHHPNIIKLLHVHRAFNDRDIYLVFEYMETDLHVVIRANILEEIHKQFIIYQLL
KTMKYLHSAEILHRDMKPSNLLVNSDCTMKVADFGLARSILSLEGEQASRPVLTDYIATR
WYRPPEILLGSTRYTKGVDMWSVGCILGELMLGKPIFPGRSTTNQLELICSVTGMPSAAD
VAATNSQFAHAMLRDIHCAHRRTFAELLPSASADALDLIERLMCFNPNRRMTAAEALEHP
YVAAFHRPDDEPVATEPITVSLPDSQRLPLAKYRDAIYEQIAALRRSSTSADQRQRAERQ
AAGSTASRKTSVSSASAGGSRGGTGTSGVTRPATSSSSSAAAGAAPQRSVVKPTSTSAVN
EASSSKAYARPAFRSATSAASGLESRPVAREAAVRK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccgaaatcgagtcgcatattctgaagaagtatgagattcaagcacagctagga
cagggtgcctacggcatcgtttggcgcgccctggagcgcaaacacaaccgcgtcgttgca
ctcaagaaaatttacgacgccttccaaaactcgaccgatgcacagcgcaccttccgcgag
atcatgtttctgcaccggctgcaccacccgaacatcatcaagctgctgcacgttcatcgt
gccttcaacgatcgcgacatatacctggtcttcgaatacatggagaccgacctgcacgtg
gtgattagggcaaacatcttggaggaaattcacaaacagttcatcatctaccagctgctc
aagacgatgaagtacctgcattctgctgagattcttcaccgtgatatgaaaccaagcaat
ctgctcgtaaacagcgactgcacaatgaaagtggctgacttcggtctcgcgcgctctatc
ctgtcccttgagggtgaacaggcgtcgcggccggtgctaacggactacattgcgacacgg
tggtaccgcccgccggagattttgctcggctcgacacgatacactaagggcgtggatatg
tggtctgtgggctgcattcttggggagttgatgctgggcaagcccatctttcccggccga
tccaccacgaaccagttggagctgatctgcagcgtgacgggcatgccctccgcggcggat
gtggcggcgaccaactcgcagtttgcccacgcgatgcttcgcgacatccactgcgcgcat
cgacgcacgttcgctgagctgctgccaagcgcttccgccgacgcgttggacctgatcgag
cgccttatgtgtttcaacccaaaccgtcgcatgactgccgccgaggccctggagcacccg
tacgtcgctgcctttcaccgtcctgacgacgaaccggtggcgaccgaacccatcaccgtc
tctctccccgacagccagcgtctgcccttggccaagtacagggacgccatctacgagcaa
attgccgcgctgcgccgtagctccacgtccgccgatcaacgacagcgcgcggagcgacag
gccgccggcagcaccgccagccgcaagacgtccgtcagcagcgcctccgctggcggctct
cgagggggcaccggtacatctggggtcacgcgacccgccacgagcagcagcagcagcgcc
gccgcaggggcggctccgcagcgcagtgttgtgaagcccacctcaactagcgcggtcaac
gaggcatcatcttcgaaggcgtacgcccgccccgccttccgctcggcaacgtctgccgcc
tctggtctggaaagcagacccgtcgcgcgtgaggcagcggtgcgcaagtga

DBGET integrated database retrieval system