KEGG   Leishmania infantum: LINJ_36_0860Help
Entry
LINJ_36_0860      CDS       T01112                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
lif  Leishmania infantum
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:lif00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    LINJ_36_0860
  Replication and repair
   03420 Nucleotide excision repair
    LINJ_36_0860
Transcription machinery [BR:lif03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     LINJ_36_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:285965..287638
Genome map
AA seq 557 aa AA seqDB search
MPSSSSALDVPLVEVICSYPTREGLCAECPALLLLVYQHVVAELQAGRRAVDVFRGTSRQ
DHLSELLGVRSLSELFEHLYPLSQSCTLDESTAGSQFWRQARATLEAAWAPPHDAKARAL
LTQVRGQPRFRFCGPRDAETPGEGYPLHPVSLERALATSKRFLRTAMTCALDGSTDALAG
RQPELRAVLQLAHLVPHTPSTGAPPRKEVTPEGISFCMVSLQQRWWVLVNAALERVLLLT
RAAANGNGNTSGSSGVTKSLLWQLLAVLSVLDTAHYVFAFPERQQDLAAHHLLARLSEVG
LVYPLLSNDRKCFVLSPDFLHAIHWHASTPLSLTFNHHLLRSVSGVSDIRREDTDTIITE
TNFRLYAYTDDADLLNILNQFAKLEEIVNGNLHCYRVTRDSFASAMRKGITAAQVLRFLS
LRAHPSMLRRHGEREENGDTTSPSSAGGASSSFTFSASPRRRAVAGTCGSTTSIDAVSTL
VVPQSFCDQMHMWESECRRVVFEHHVVLLRNMSTEQQKAVTAYLIDAGEVDAVAHAERGY
MVIREEVFERLVAPLLR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgagctcctcggcattggacgtgccgcttgtagaagtcatctgcagctatccg
acccgcgaggggctatgcgccgagtgccctgcactgctgctgctcgtctaccagcacgtt
gtagcggagctgcaggcggggcgacgcgccgtggacgtgttccgtggcacctcgcggcag
gaccacctgagcgaattactcggtgtgcgctccttgtcggagctgtttgagcatctctac
ccgctgtcgcagtcttgcaccctcgatgagagcactgcgggctcgcagttctggaggcag
gcacgggctaccttggaggccgcgtgggcgccgccgcacgacgcaaaggcgcgtgccctt
ctcacgcaggtgcgcggccagccgcgattccgcttttgcgggccgcgcgacgccgagacg
cccggggagggctatccactgcaccctgtatcgttggagcgggccttggcaacaagcaag
cgcttcctccgcactgcgatgacctgcgcactggacgggtcaacggatgccctggccggg
cggcaaccggagctgcgcgcggtgctgcagctggcccaccttgttccccatactccgtcg
acgggagcgcctccgagaaaagaagtcacgccggaggggattagcttctgcatggtgtcg
ctgcagcagcggtggtgggtactggtgaacgcggcgctggagcgcgttctgctgctcact
cgcgctgccgcgaatgggaacggtaacaccagcggcagcagcggcgtcacaaaatcgctt
ctctggcagctgctggcggtgctgtctgtcctagacactgcgcactacgtcttcgccttc
ccagaaaggcagcaggatctcgcggctcaccatcttctcgcacggctgtccgaggtcggg
ctggtgtaccccttactcagcaacgaccgcaagtgctttgtcttgagtcctgacttcctg
cacgccattcactggcacgcgagcacgccgctgtccctcaccttcaatcatcacctcctg
cgaagcgttagcggcgtcagcgacatacgtcgcgaggacaccgacaccatcatcaccgaa
acgaacttccgtctgtacgcgtacaccgacgatgctgacctgctcaacattttgaaccag
ttcgcgaagctggaggagatcgtgaacgggaatctccactgctaccgcgtgacgcgggac
agctttgcctccgcgatgcgcaagggcatcaccgctgcacaagtcctacgctttctttcg
ctgcgagcgcaccccagcatgcttcgccggcacggggagcgggaggagaacggtgacacg
acgtcgccatcgtctgctggcggcgcctcctcttccttcactttttcagcgtcccctcgt
cgtagggctgttgcgggcacgtgtgggagcaccacctccattgatgcggtgtcgacgctt
gtggttccgcagtccttctgcgaccaaatgcacatgtgggagagcgagtgtcgccgcgta
gtgtttgagcaccacgttgtcctgctacgcaacatgtcaacggagcaacagaaggcggtg
acagcgtatttgatcgatgcaggggaggtcgatgccgttgcgcacgctgagcgcggctac
atggtgattcgtgaggaagtcttcgagcgtcttgtcgcaccacttttaaggtga

DBGET integrated database retrieval system