KEGG   Leishmania infantum: LINJ_36_1700Help
Entry
LINJ_36_1700      CDS       T01112                                 

Definition
putative clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
lif  Leishmania infantum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:lif00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    LINJ_36_1700
Exosome [BR:lif04147]
 Exosomal proteins
  Proteins found in most exosomes
   LINJ_36_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:complement(626159..631240)
Genome map
AA seq 1693 aa AA seqDB search
MDSPSISAEVFQLNSVSGGLRPGSISFKNVTLESEKYVCVRDVQGDGPTSLVIVDLEKRE
SIRNNVKDAESCIMNPKSKILALRSGRNLQVFDVDASRRLKATLFHEDVAYWRWIDDRTL
GVVTAKAVYHWSLDTAADDAPQHIFDRSADYDSSVQVLSYRSDEQKKWLVVTGVARDPSG
IMVGKALLYSVENRSSRVLDGHACCFISTSTPSEPRKCNVMCLAWNSPQQGGQVMIMELP
TGSKTDLSMLRRVYSVNIQPGDFPVAMNVSDRHKLLTVATSRGSFALMDIFTGTILVEQQ
FSSSVVFCGAADNKVGGVLCVNNQGAVMRIGPNDNGIIGFVKNRMHNAELALRIASTANL
GGVDDLFKVQLDNFLRNGNVEEAVRMCLRAPGNSLRTREILMRFMQMPQQPGQPPAISTY
FKIALAETSLNECESVELARAVVPKGGIGYVKQQFEEGKLTASEELGDLVQQADSNMALK
IFHQGNAHTKVLNLLLQRNETQKAVEYCKRANFSPDWRVIMNNFIRVAPQDAVNLGLMLY
REMGDRPVLTADEVVDMFVSAQQIQQATEFLLEILRDHNDESTMELQTKLLEMNLKYSHP
SVADKIFVRKICQCYDGMKLAPLCERAGLHQHAIDCYIMAQKQDSDLNNLASIRRCLQQL
QNFNPEWLVDFFGKLNKQDSLKCLEDLCTNSRHNFKVIVQVATKYSDALGAADLIDLFLE
HSLYDVLYYYLGAVVPYTRDAEVHFRYIEAAAEMGQMQELERMTRESPCYDAERTKNYLK
SKKLTDMWPFINVCDQHNMVNEMVHYLVETGNESCIEQYLTRRSPGKTPQVVQALIECNV
SEEFIKNMLTAVGTMCPIEELVDCVEEVGRLHLIKQWLEDRRSEKKTDKALYNALAKIYV
DIGQSPEQFLSENEYYDSQVVGKYCETRDPNLAYIAYCRGHCSEMMIDLCHRNGMHKQLA
RYLVKEQNLDLWASVLGQNSAERQQLIESVQQIALPESESSEEVSTTVRAFMNANLTEEL
TSLLGQIVVHGRFRRNRFLENLLIMSAVRARKDKVMEYVTTLEDYDAKDIAHVASGAGMH
EIAFVVYTRHNMQKEAITVLLQDMNDVSRGRAFAQKTDAAVVWSVLGEYLVKQDEVHEGI
ECLIRAKNPDLVVEVTSAAERTNQFGDLIKYLTMARQCSRAKDNKIDTALVITYAKTGRL
EELEEFLKETHNVKIGAIADKCFQDKLYESARVLYTVANNYARVASTEVMLSNLSAAVEA
AKKAKSIHTYKEVNLACIEAGDLKLAGVCAVPVVLKAEEVSGMCNRYESRGLWEELFSVL
RNASSHQGAHMSIFTEMGVLLAKYRPEKLMEHVNMYAKKINTHKMITVCEQYHHWVVLRV
LHINNEDWLAATNSMMQHHADAFDHEIFKDAVSHLGASDLLYTAIGFYLKTHPEQLNDFL
SSIFKRVDPERVMTETKKVAPIHVIRTYLEAAQERNAKKVNEALNNLYIEEEDFKALRHS
VETYNNFDSEELSSRLEKMELFEFRKIALLLHRKNKRYSHAVAVAKENELFEEAIDTAAE
SGDSELVSSLLDYFVKDYPECFAACLYTCYDLLKPATVLQKAWLNQRTEMAMPYMIQVLQ
DYSNKIEKMEKSMMDAQTAAKDAARRAGPVQGPGSVPLMIEQGGGMPMNGMPVGAPPQLG
FGMPPQFGSGRPF
NT seq 5082 nt NT seq  +upstreamnt  +downstreamnt
atggactctccttcgatttctgcggaggtctttcagctcaactcggtctcaggtggcctc
cgcccgggctccatttccttcaagaatgtcaccttagagagcgagaagtatgtctgcgtc
cgcgatgttcagggcgacgggccgacgtcactcgtcattgtcgatctcgagaagcgcgag
agcattcgaaacaatgtcaaggatgcggagtcatgcatcatgaaccccaagtcgaagatc
ctggcactacgcagcggccgcaatctgcaggtgttcgacgtggacgcctcgcggcggctt
aaggcgacgctctttcatgaggatgttgcgtactggcgctggatcgacgaccgcaccctc
ggcgttgtgacggcaaaggcagtctaccactggagcctcgacaccgccgccgacgacgcg
ccgcagcacatcttcgaccgaagcgcggactacgacagcagtgtgcaggtgctctcatac
cgcagcgacgagcagaagaaatggctcgtcgtgactggtgtggcgcgtgacccatcgggt
atcatggtgggcaaggcgctgctgtacagcgtcgagaaccgcagcagtcgcgtgctcgac
ggccatgcgtgctgcttcatctccacctccactccatccgagcctcgcaagtgcaatgtg
atgtgcctcgcctggaacagcccgcagcaaggcggccaggtcatgatcatggagctgccg
accggctccaagacagatttgtcgatgctgcggcgggtttacagcgtaaacattcagccc
ggcgacttcccggtcgccatgaacgtctcggaccgccacaagctgttgaccgtggcgacg
agccggggcagctttgcgctgatggacatcttcaccggaaccatcctggtagagcagcag
ttttcgagctcggtggtgttttgcggcgcagccgacaacaaggtcggcggcgtgttgtgc
gtcaacaaccagggcgccgtcatgcgcatcggccccaacgacaacggtatcatcggcttt
gtcaagaaccgcatgcacaacgccgagctggccctgcgcatcgcctccacggcgaacctg
ggcggcgtcgacgatctcttcaaggtgcagctggacaacttccttcgcaatggcaacgtc
gaggaggccgtccgcatgtgcctgcgtgccccagggaactcgctgcgcacccgcgagatt
ctcatgcgtttcatgcaaatgccgcagcaaccgggccagccgccggctatctcgacctac
ttcaagatcgcgctggcggagacgagcctgaacgagtgcgagtctgtcgaacttgcgcgc
gcggtggtgcccaagggcggcatcggctacgtgaagcagcagtttgaagagggaaagctg
acggcctccgaggagctcggcgacctggtgcagcaggcggactccaacatggcgctgaag
atcttccaccagggcaatgcccacaccaaggtgctgaacttgctgctgcagcgcaacgag
acgcagaaggcggtggagtactgcaagcgcgcgaacttctcgccggattggcgtgtcatc
atgaacaactttatccgagttgcgccgcaggacgccgtcaaccttggcttgatgctgtac
cgagagatgggcgataggccggtgctcaccgcggatgaggtggtggacatgttcgtgtcg
gcccagcagattcagcaggcgaccgagttccttctggagatcctccgcgaccacaatgac
gagtcgaccatggagctgcaaacgaagctgctcgagatgaacctcaagtactcacatcca
tccgtcgccgataagatcttcgtccgcaagatctgccagtgctacgacggcatgaagctg
gcgccgctttgcgagcgcgctggtctgcaccagcacgcgattgactgctacataatggct
cagaagcaggactccgacctcaacaacctcgccagcatccgccgctgcctgcagcagctg
cagaacttcaaccccgagtggctcgtggactttttcggcaagctcaacaagcaggacagc
ctcaagtgcctcgaggatctctgcaccaactcgcgccacaacttcaaggttattgtgcag
gtggccaccaagtacagtgacgccctcggcgccgccgacctcatcgacctattcctcgag
cacagcctgtacgacgtcctctactactatctcggggccgtggtgccgtacacgcgtgat
gccgaggtgcacttccgctacatcgaggccgctgctgagatgggccaaatgcaggagctg
gagcgcatgacccgcgagagcccgtgctacgacgccgagcggacgaagaactaccttaag
agcaagaaactgacggacatgtggcccttcatcaacgtgtgcgatcagcacaacatggtg
aacgagatggtgcactacctggtggagacgggcaacgagagctgcatagagcagtacctg
acgcggcgaagccccggtaagacgccgcaggtggtgcaggccctgatcgagtgcaacgtg
agcgaggagttcatcaagaacatgctcacggcggttgggacgatgtgccccattgaagaa
cttgttgactgtgtggaggaggtgggccggctgcacctcatcaagcaatggctcgaggac
cgccgcagcgagaagaagacggacaaggcgctgtacaacgcgctggccaagatctacgtc
gacattggccagagccccgagcagttcctgtcggaaaacgagtattacgattcgcaggtg
gtgggcaagtactgcgaaacgcgcgaccccaacctcgcgtacatcgcgtattgccgcggc
cactgcagcgagatgatgatcgacctctgccaccgcaacggcatgcacaagcagctggcc
cgctacctggtgaaagagcagaaccttgatctatgggcgagcgtgctggggcagaactcg
gcggagcggcagcagcttattgagtcggtgcagcagatcgcgctgccagagagtgagtcg
agcgaggaggtgagcacgacggtgcgcgccttcatgaacgccaatctgacggaggagctc
acctcgctgctgggccagattgtggtgcacggccgcttccgcaggaaccgcttcctcgag
aatcttctgatcatgtctgcggtgcgtgcccgcaaggataaggtgatggagtacgtgaca
acgctggaggactacgacgccaaggacattgcgcacgtcgcctcgggcgccggcatgcat
gagatcgcgtttgttgtatacacgcgccacaacatgcagaaggaggccatcacggtgctc
ctgcaggacatgaacgacgtttcgcgcggccgcgcctttgcccaaaagacggacgctgcc
gtcgtgtggtctgtgctaggtgagtacctggtaaagcaggacgaggtgcacgagggtatc
gagtgccttattagggcgaagaaccccgacctcgttgtcgaggtgacgtctgcggcggag
cgcacgaaccagttcggcgacctgatcaagtaccttacgatggcccgccagtgctcgcgc
gcaaaagacaacaagattgacacggcgctcgtcatcacgtacgccaagacgggccgcctc
gaggagctggaggagttcctaaaggagacgcacaacgtcaagatcggcgccattgccgac
aagtgcttccaggacaagctgtacgagtcggcgcgcgtgctgtacaccgtggcgaacaac
tacgctcgcgtggcgtcgacggaggtgatgctgagcaacctgtccgccgccgtagaggcg
gctaagaaggccaagtcgatccacacgtacaaggaggtcaacctggcatgcatcgaggct
ggggatctgaagctggctggggtctgcgccgtcccagtggtgctcaaggcggaggaggtg
agtggcatgtgcaaccgctacgaaagccgcggcctctgggaggagctattctcggtgctc
aggaacgcctctagccatcagggtgcgcacatgtctatcttcaccgagatgggcgtcttg
ctggccaagtatcggcccgagaagctcatggagcacgtgaacatgtacgcgaagaagatc
aacacgcacaagatgattaccgtctgcgagcagtatcaccactgggtcgtgctgcgtgtg
ctgcacatcaacaacgaggattggctggctgcgaccaactcgatgatgcagcaccacgca
gacgccttcgaccacgagatcttcaaggacgcggtgagccacctcggcgccagcgatctc
ctgtacaccgcgattggcttctacctcaagacgcacccggagcagctgaacgacttcctg
tcctccatcttcaagcgcgtggatccggagcgggtgatgacggagacgaagaaggtggca
cctattcacgtgattcgcacctacctcgaggccgcgcaggagcgcaacgccaagaaggtg
aacgaggccctcaacaacctctacatcgaggaggaagacttcaaggcgctgcgccactcc
gtcgagacgtacaacaacttcgactcggaggagctgtcgtcgcggctagagaagatggag
ctctttgagttccgcaagatcgctctgctgctgcaccgcaagaacaagcgctattcgcac
gccgtcgcggtggccaaggagaacgagctgttcgaggaggccatcgacacggcagccgag
agcggcgacagcgagctggtgagcagcctgctggactacttcgtgaaggactatcccgag
tgttttgccgcgtgcctctacacatgctacgacctgctgaagccggcgacggtgttgcag
aaggcgtggctgaatcagcgaacggagatggcgatgccgtacatgattcaggtgctccag
gactactcgaacaagatcgaaaaaatggagaagtcgatgatggacgcgcagactgcggcg
aaggacgcggctcgtcgcgccggtccagtgcaggggcccggctctgtgccgctaatgatc
gagcagggtggcggcatgccgatgaacgggatgccggtcggtgcaccgccgcagttgggc
tttggcatgccgcctcagttcggatctggccggcctttctag

DBGET integrated database retrieval system