KEGG   Leishmania infantum: LINJ_36_2390Help
Entry
LINJ_36_2390      CDS       T01112                                 

Definition
guanylate kinase-like protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lif  Leishmania infantum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LINJ_36_2390
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LINJ_36_2390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:896270..897259
Genome map
AA seq 329 aa AA seqDB search
MSVAPKAPMPAISSVAAASAAHKTAQQAVGPLKGTVALRRLVDMLLFVGPSGSGKSTVIR
RLQRDWPTLFEFSVSHTTRCPRRGEVHGQHYYFVTMEEFQQLVDAGHMIEYSRLCMPETS
SSTPPLSKPVGNLYGTSKKALHTVLARNRVVLMDTDLLGAINIRRYCSREVVSTRPVTVS
QAQRSIAQRDDDAAPAAQTLLTLSTPRHASVSLENEHAADPTTANPSKDSMLPSSPFYAA
PVVTRTLRCMIIFIAPPSMQVLEQRLRERKTETEASIQLRMKVNRQWMQWAKENQSFFDH
YIVNDNLDLCYAKVREIVRAEVLMVDSTL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggcaccaaaagcgccgatgccagcgatttcatcggttgccgccgcgtctgct
gcccacaaaactgctcagcaggccgtgggccctctcaagggcactgtcgccctcaggcgc
ctcgtggacatgcttttgtttgtcgggccaagcggctctggcaagtctacggtgattcgc
cggctgcagcgggactggcccacgctatttgagttcagcgtgagccacacaacccgttgc
ccgcggcgcggcgaggtgcatgggcagcactactactttgtcaccatggaggagttccag
cagctggtcgacgcgggtcacatgattgaatactcgcggctctgcatgcccgaaacgtcg
tcgtcgacgcctccgctgagcaagccagtcggcaacctctacgggactagcaagaaagcc
ctgcacacggtgctcgcgcgcaatcgcgtcgtgctaatggacactgatctgctcggcgcc
atcaacattcggcgttactgctctcgtgaggtggtgagcacgaggccggtgaccgtttcg
caagcgcagcgcagtatcgcgcagcgcgacgatgacgccgctccggccgcgcagaccctg
ctaaccctctcaacgcctcggcatgcatccgtctctctggagaacgagcacgccgcggac
cccacgactgcgaatccatccaaggattcgatgttgccgtcgtcccctttctatgccgca
cccgtggtcacacgcacgctgcgctgcatgatcattttcatcgcgccacctagcatgcag
gtgctggagcagcggctgcgggaacgaaagaccgaaacagaagcttcgatccagctgcgc
atgaaggtgaatcggcagtggatgcagtgggccaaggagaatcagtcgttctttgaccac
tacatcgtgaacgacaaccttgatctctgctacgccaaggtgagggagattgtgcgggca
gaggtgctcatggtggacagcactctgtga

DBGET integrated database retrieval system