KEGG   Leishmania infantum: LINJ_36_2390Help
Entry
LINJ_36_2390      CDS       T01112                                 

Definition
(RefSeq) guanylate kinase-like protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lif  Leishmania infantum
Pathway
lif00230  Purine metabolism
lif01100  Metabolic pathways
Module
lif_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LINJ_36_2390
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LINJ_36_2390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_29 AAA_22 MMR_HSR1 Rad17 AAA_18 RsgA_GTPase ABC_tran RNA_helicase NACHT AAA_28 Mg_chelatase G-alpha AAA_5 AAA_30 RNA_pol_N AAA_23
Motif
Other DBs
NCBI-GeneID: 5073923
NCBI-ProteinID: XP_001469819
UniProt: A4IDK0
Position
36:896270..897259
Genome map
AA seq 329 aa AA seqDB search
MSVAPKAPMPAISSVAAASAAHKTAQQAVGPLKGTVALRRLVDMLLFVGPSGSGKSTVIR
RLQRDWPTLFEFSVSHTTRCPRRGEVHGQHYYFVTMEEFQQLVDAGHMIEYSRLCMPETS
SSTPPLSKPVGNLYGTSKKALHTVLARNRVVLMDTDLLGAINIRRYCSREVVSTRPVTVS
QAQRSIAQRDDDAAPAAQTLLTLSTPRHASVSLENEHAADPTTANPSKDSMLPSSPFYAA
PVVTRTLRCMIIFIAPPSMQVLEQRLRERKTETEASIQLRMKVNRQWMQWAKENQSFFDH
YIVNDNLDLCYAKVREIVRAEVLMVDSTL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggcaccaaaagcgccgatgccagcgatttcatcggttgccgccgcgtctgct
gcccacaaaactgctcagcaggccgtgggccctctcaagggcactgtcgccctcaggcgc
ctcgtggacatgcttttgtttgtcgggccaagcggctctggcaagtctacggtgattcgc
cggctgcagcgggactggcccacgctatttgagttcagcgtgagccacacaacccgttgc
ccgcggcgcggcgaggtgcatgggcagcactactactttgtcaccatggaggagttccag
cagctggtcgacgcgggtcacatgattgaatactcgcggctctgcatgcccgaaacgtcg
tcgtcgacgcctccgctgagcaagccagtcggcaacctctacgggactagcaagaaagcc
ctgcacacggtgctcgcgcgcaatcgcgtcgtgctaatggacactgatctgctcggcgcc
atcaacattcggcgttactgctctcgtgaggtggtgagcacgaggccggtgaccgtttcg
caagcgcagcgcagtatcgcgcagcgcgacgatgacgccgctccggccgcgcagaccctg
ctaaccctctcaacgcctcggcatgcatccgtctctctggagaacgagcacgccgcggac
cccacgactgcgaatccatccaaggattcgatgttgccgtcgtcccctttctatgccgca
cccgtggtcacacgcacgctgcgctgcatgatcattttcatcgcgccacctagcatgcag
gtgctggagcagcggctgcgggaacgaaagaccgaaacagaagcttcgatccagctgcgc
atgaaggtgaatcggcagtggatgcagtgggccaaggagaatcagtcgttctttgaccac
tacatcgtgaacgacaaccttgatctctgctacgccaaggtgagggagattgtgcgggca
gaggtgctcatggtggacagcactctgtga

DBGET integrated database retrieval system