KEGG   Leishmania infantum: LINJ_36_2450Help
Entry
LINJ_36_2450      CDS       T01112                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lif  Leishmania infantum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LINJ_36_2450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LINJ_36_2450
   00052 Galactose metabolism
    LINJ_36_2450
   00500 Starch and sucrose metabolism
    LINJ_36_2450
   00520 Amino sugar and nucleotide sugar metabolism
    LINJ_36_2450
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    LINJ_36_2450
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LINJ_36_2450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:923328..924563
Genome map
AA seq 411 aa AA seqDB search
MSLTDEIQLEQLAPTIKGDASWSTGPIYVVCDVGGTNARVGFAQAAQHDRSGLHIIYVRF
RVTKRDIRQLLEFFDEVLQHLKKNLPYRAGPFLRRVASGAVSVPGPVTNGQLAGPFNNLK
GTARLADYPVELFPKGRSALLNDLEAGSYGVLALSNAGMLSDYFKVMWKGTQWDALSEGK
PVGSTIGHGRCMVVAPGTGVGSSLIHYVGVSDSYVVLALECGCLSMSWCANEDSKYVQAL
AGYMASKARAKGLDSTVAPIWEAATSGSGLEFNYAYEKEGPKASVPLKSAPEVAKLAKAG
SDPAAVAAMDRLYKNLMGLTAETTMQFLPLTCVLMGDSIVSNSFYFDNPENVKRLQARIN
EHTMERQLKFLSRTTFLRQVRSVNINLLGCLGFGSQLSDPADQLAPNKSNL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcacagacgagatccaactcgagcagctggccccgaccatcaagggcgacgcc
tcctggtccaccggccccatctacgttgtgtgcgatgttggcggcacgaacgcgcgcgtc
ggctttgctcaagcggcgcagcacgatagaagcggcctgcacatcatctatgtccgcttc
agggtgacgaagcgcgacatccgccagctactcgagttcttcgatgaggtgctgcagcac
ctgaagaagaacctgccctaccgcgctggtcccttcctgcgtcgtgtcgcgtccggtgcc
gtgagtgtgccgggacctgtcaccaacggacagctcgccggccccttcaacaacctgaag
ggcactgcgcggctggcggactacccagtggagctgtttccaaagggccgcagcgcgctt
ctgaacgatctggaggctggctcctatggcgtgctggctctgagcaacgccggcatgctg
tccgactacttcaaggtcatgtggaagggcacgcagtgggacgcgctgtcggaaggcaag
cccgtcggcagcaccatcggccacggccgctgcatggtcgtggcccccggcaccggcgtc
ggctcctctctcatccactatgtgggtgtctcggacagctatgtcgtgctggcgctggag
tgcggctgtttgtccatgtcttggtgcgccaacgaggactcgaagtacgtgcaggcactt
gccggttacatggcgtccaaggcgcgtgcgaagggcctggactcgacggtggcccccatc
tgggaggctgcgacaagcggtagtgggttggagttcaactacgcgtacgagaaggagggg
ccgaaggcatccgttcccctcaagtccgctcccgaggtagccaagctcgccaaggctggc
agcgacccggccgccgtggccgccatggaccgtctctacaagaacctcatgggcctcaca
gctgagacgacaatgcagttcctgccgctgacatgtgtgctgatgggcgacagcattgtt
tccaacagcttttacttcgataacccagagaatgtgaagaggctgcaggctcgcataaac
gagcacacgatggagcgtcagttaaagttcttgagtcgcaccacgttccttcgccaggtg
cgcagtgtgaatatcaacctgctgggctgccttggatttggtagccagctctccgacccg
gcagatcagttagcgccaaacaagtccaacttgtga

DBGET integrated database retrieval system