KEGG   Leishmania infantum: LINJ_36_2450Help
Entry
LINJ_36_2450      CDS       T01112                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lif  Leishmania infantum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:lif01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lif00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lif00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lif00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lif00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:lif00524]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:923328..924563
Genome map
AA seq 411 aa AA seqDB search
MSLTDEIQLEQLAPTIKGDASWSTGPIYVVCDVGGTNARVGFAQAAQHDRSGLHIIYVRF
RVTKRDIRQLLEFFDEVLQHLKKNLPYRAGPFLRRVASGAVSVPGPVTNGQLAGPFNNLK
GTARLADYPVELFPKGRSALLNDLEAGSYGVLALSNAGMLSDYFKVMWKGTQWDALSEGK
PVGSTIGHGRCMVVAPGTGVGSSLIHYVGVSDSYVVLALECGCLSMSWCANEDSKYVQAL
AGYMASKARAKGLDSTVAPIWEAATSGSGLEFNYAYEKEGPKASVPLKSAPEVAKLAKAG
SDPAAVAAMDRLYKNLMGLTAETTMQFLPLTCVLMGDSIVSNSFYFDNPENVKRLQARIN
EHTMERQLKFLSRTTFLRQVRSVNINLLGCLGFGSQLSDPADQLAPNKSNL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcacagacgagatccaactcgagcagctggccccgaccatcaagggcgacgcc
tcctggtccaccggccccatctacgttgtgtgcgatgttggcggcacgaacgcgcgcgtc
ggctttgctcaagcggcgcagcacgatagaagcggcctgcacatcatctatgtccgcttc
agggtgacgaagcgcgacatccgccagctactcgagttcttcgatgaggtgctgcagcac
ctgaagaagaacctgccctaccgcgctggtcccttcctgcgtcgtgtcgcgtccggtgcc
gtgagtgtgccgggacctgtcaccaacggacagctcgccggccccttcaacaacctgaag
ggcactgcgcggctggcggactacccagtggagctgtttccaaagggccgcagcgcgctt
ctgaacgatctggaggctggctcctatggcgtgctggctctgagcaacgccggcatgctg
tccgactacttcaaggtcatgtggaagggcacgcagtgggacgcgctgtcggaaggcaag
cccgtcggcagcaccatcggccacggccgctgcatggtcgtggcccccggcaccggcgtc
ggctcctctctcatccactatgtgggtgtctcggacagctatgtcgtgctggcgctggag
tgcggctgtttgtccatgtcttggtgcgccaacgaggactcgaagtacgtgcaggcactt
gccggttacatggcgtccaaggcgcgtgcgaagggcctggactcgacggtggcccccatc
tgggaggctgcgacaagcggtagtgggttggagttcaactacgcgtacgagaaggagggg
ccgaaggcatccgttcccctcaagtccgctcccgaggtagccaagctcgccaaggctggc
agcgacccggccgccgtggccgccatggaccgtctctacaagaacctcatgggcctcaca
gctgagacgacaatgcagttcctgccgctgacatgtgtgctgatgggcgacagcattgtt
tccaacagcttttacttcgataacccagagaatgtgaagaggctgcaggctcgcataaac
gagcacacgatggagcgtcagttaaagttcttgagtcgcaccacgttccttcgccaggtg
cgcagtgtgaatatcaacctgctgggctgccttggatttggtagccagctctccgacccg
gcagatcagttagcgccaaacaagtccaacttgtga

DBGET integrated database retrieval system