KEGG   Leishmania infantum: LINJ_36_3160Help
Entry
LINJ_36_3160      CDS       T01112                                 

Definition
putative glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lif  Leishmania infantum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LINJ_36_3160
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LINJ_36_3160
Enzymes [BR:lif01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LINJ_36_3160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:complement(1221650..1222108)
Genome map
AA seq 152 aa AA seqDB search
MASIFTYSAVQNGKTVFLQKYSGYATLIVNVASRCSLASTNIEMLNEVQQAYGSRRFTVL
AFPCAQFANQEPLNNTEIAQWCKDLGLLFPVFDRVNVKGSSADPLFQMLRVQKGAPLWNY
TKYLCDRSGVPRRKLKPGCSMDTLRQSIECVL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcatccatcttcacctatagcgctgtgcaaaatggcaagactgtttttttgcaaaag
tactctggctatgcgacgcttatcgtgaacgtggcgtcgcgatgcagccttgcatccacc
aacatcgagatgctgaacgaggtgcaacaggcgtatggctcccgcaggttcaccgttctc
gcgtttccgtgcgcgcagtttgcgaatcaagagccgctcaacaataccgaaattgcgcag
tggtgcaaggaccttgggctgctctttcctgtctttgaccgggtcaacgtgaagggttcc
tcagccgacccgctgtttcagatgctacgggtgcagaagggagctcccctgtggaactac
accaagtacctgtgtgaccgcagcggtgtgccgcgccgtaagctgaagcctggctgctcc
atggacacgctgcggcagtccatcgagtgtgttttgtag

DBGET integrated database retrieval system