KEGG   Limnohabitans sp. 63ED37-2: L63ED372_01389Help
Entry
L63ED372_01389    CDS       T04121                                 

Gene name
fadA_2
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lih00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    L63ED372_01389 (fadA_2)
   00630 Glyoxylate and dicarboxylate metabolism
    L63ED372_01389 (fadA_2)
   00640 Propanoate metabolism
    L63ED372_01389 (fadA_2)
   00650 Butanoate metabolism
    L63ED372_01389 (fadA_2)
  Lipid metabolism
   00071 Fatty acid degradation
    L63ED372_01389 (fadA_2)
   00072 Synthesis and degradation of ketone bodies
    L63ED372_01389 (fadA_2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L63ED372_01389 (fadA_2)
   00310 Lysine degradation
    L63ED372_01389 (fadA_2)
   00380 Tryptophan metabolism
    L63ED372_01389 (fadA_2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L63ED372_01389 (fadA_2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L63ED372_01389 (fadA_2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    L63ED372_01389 (fadA_2)
Enzymes [BR:lih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     L63ED372_01389 (fadA_2)
Exosome [BR:lih04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L63ED372_01389 (fadA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1439305..1440480)
Genome map
AA seq 391 aa AA seqDB search
MTNAVIVSTARTPLAKGWKGAFNMTHGATLGGHAVQHAVARAGIDAAEVEDVIMGCASPE
GATGANIARQIALKAGLPISVSGMTVNRFCSSGLQTIALAAQRIIAGEGQVYVAGGVESI
SCVQQEMNTHMMQDLALAKMKPEIYWNMLQTAEQVAKRYKIGRDVMDAYGAASQQKACAA
QAAGLFSDEIAPITVTQGVIDKIMGMTTKQVTVSVDEGLREGTTVEGISGLRSALPGGLV
TAGNASQFSDGAGACVLMDEKLAEQRGLKPMGRFLGFAVAGCEPDEMGIGPVYAVPKALA
RLGLTVNDIDLWELNEAFAVQVLYCRDKLGIPADRLNVNGGAIAVGHPYGVSGQRLTGHA
LIEGKRRGAKRVAVTMCIGGGMGACGIFEVL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgctgtcatcgtatctaccgcacgcaccccgctggccaagggctggaagggc
gctttcaacatgacccacggtgccactttgggcggccacgcggtgcaacacgctgtggcc
cgcgcaggcattgacgcggccgaagtcgaagatgtgatcatgggctgcgccagccccgag
ggcgccaccggcgccaacatcgcccgccagatcgcgctcaaggctggtttgcccatctcg
gtgtcgggcatgaccgtcaaccgtttttgctcttctggcttgcaaaccatcgctttggcc
gctcaacgcatcatcgcgggcgaaggccaggtttatgtggccggtggtgtggaaagcatc
tcttgtgtgcagcaagaaatgaacactcacatgatgcaagacttggctttggccaagatg
aaaccagagatctactggaacatgctgcaaacggctgaacaagtggccaagcgctacaaa
atcggccgtgatgtgatggacgcctacggtgcggccagccagcaaaaagcgtgcgccgcg
caagccgccgggttgttcagcgacgaaatcgcccccatcaccgtcactcaaggtgtgatc
gacaagatcatgggcatgaccaccaaacaagtgaccgtgagtgtggacgaaggtttgcgc
gaaggcaccaccgtggaaggcatcagtggcctgcgctcggcgctgcccggtggtttggtc
accgccggtaatgccagccagttctcggacggtgcaggcgcttgtgtgctgatggacgaa
aaactggccgagcagcgcggcttgaagcccatgggccgattcctcggttttgccgtggcc
ggttgcgagcccgatgaaatgggcattggccccgtgtacgccgtgcccaaagctttggcg
cgtttgggcctcacggtcaacgacattgacttgtgggaactgaacgaagcctttgccgtg
caggtgctgtattgccgtgacaaactgggcattccggccgatcgcctgaacgtcaacggc
ggcgcaatcgctgtgggtcacccctacggtgtgtcgggccagcgcctgacaggtcacgcc
ctgatcgaaggcaagcgccgtggtgccaagcgcgtggcggtgaccatgtgcattggcggc
ggcatgggtgcttgcggcatttttgaagtgctgtga

DBGET integrated database retrieval system