KEGG   Leptospira interrogans serovar Lai 56601: LA_0035Help
Entry
LA_0035           CDS       T00098                                 

Gene name
lacA
Definition
(RefSeq) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LA_0035 (lacA)
Enzymes [BR:lil01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LA_0035 (lacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 DUF4434 Cellulase Glyco_hydro_2_C
Motif
Other DBs
NCBI-GeneID: 1149378
NCBI-ProteinID: NP_710216
UniProt: Q8FA02
Position
I:complement(37450..39426)
Genome map
AA seq 658 aa AA seqDB search
MIFGADYYPEQWTRKDWEEDISIMKEMGLSSIRLAEFAWAMMEPKEGKYDFSFFDHILSL
IQKNEMTAILGTPTATFPPWLAKKFPDIIQERDGIQRTIGTRRQACFSSPNYRKAVIKIV
TAMAKHFGNHPVVIGWQIDNEIGHEGSDIDHSQTSLKAFRIWLKNKYKTIQNLNETWGNV
FWGMIFNSFEEIPIPGRHVASNFHPSLIQDFYRFHSDTIIDFVKLQAQILRKFSVGRPLT
TNLYPSPFLPIIDMAELATYLDYISWDNYPTWGEQEAPFPHPFISAMQQYNRGLKNLPFT
VMEQISGFQGHDLLGYLPAPGQTKLWMKHSIAHGSNAIYFFRYRTARFGQEQLCYGILDH
DKKKTERYYELQKGIQEIEKYTEDFTEELFPAEVALVHDIENARNWKHQPISTGLKFSPV
PWSQVGYDIEMATWFSGMNVLNVNTHFRPASKIDFKNYKIIILPMYTMVNETVFKRLEEF
VREGGTLVLGFRTGAKDLNGWMYDSQIPGPFAEMAGIKIRKFESVGNQKVKFRFRFFPGT
CSKICEILEPTTAEVWARYTDGKKFYKGSPVITANNYHKGKVIYVGSSLEPLSFVLLYRR
ILKEAKIPFIFYGPNVEKIFRSGRKQNYEIFINHSGKKSLAGLKILDPYEVRILSKKK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgatattcggagccgattactatccggaacaatggactcgaaaagattgggaagaagac
atctctattatgaaagaaatgggtttgagttcgattcgtcttgcggagtttgcttgggcg
atgatggaacctaaagaagggaaatacgatttttctttttttgatcatattctaagttta
atccaaaaaaacgaaatgaccgcgattttaggaacccccacggcaacctttcctccttgg
cttgctaaaaaatttccagacataatccaggaaagagatggaattcagaggacaattggc
accagaagacaggcttgtttttcttcacctaactatagaaaggcggtgataaaaattgtg
accgcaatggctaaacattttggaaatcatcctgtggtaattggttggcaaatcgataac
gaaatcgggcatgaaggttctgatatagatcattctcaaacatctctaaaagcttttcga
atttggttaaaaaataaatataaaacgattcaaaacttaaatgaaacttggggaaatgtt
ttttggggaatgatttttaattcttttgaagaaattccgattcctggtcgacacgttgcg
agcaattttcatccttctttgatccaagacttttatcgatttcattcagatacaatcatc
gatttcgtaaaacttcaggcacaaattcttagaaaattttcagtcggaagacctctcact
actaacctctatccttctccatttttaccgattattgacatggcagagttggccacctat
ttagattatatttcttgggacaattatcctacttggggagaacaagaagctccgtttcct
catccgttcatctctgcgatgcaacaatacaaccgaggtttaaaaaatcttccatttact
gttatggaacaaatttctggttttcaaggacacgacctacttggttatcttccggctccc
ggacaaaccaaactttggatgaaacattctattgcacacggttcaaatgcgatttatttt
ttcagatatagaaccgcgcgtttcggtcaagaacaactttgttacgggattttagatcac
gataaaaaaaagacagaacgttattacgaacttcaaaaaggaatccaagaaattgaaaaa
tacacggaggattttacagaagaattatttccggctgaggttgctctcgtacacgacata
gaaaatgctagaaattggaaacaccagcctatttccaccggattaaaattctcacctgtt
ccttggtctcaagttggttatgatattgaaatggctacttggttttctggcatgaacgtg
ttaaacgttaacactcatttccgtcccgcttctaaaatcgattttaaaaattataaaatt
ataatacttccaatgtatacaatggttaacgaaacagtttttaaacgtttggaagaattt
gtaagagaaggtggaactttagttttaggttttagaactggagctaaagatttaaacgga
tggatgtatgattctcaaattccgggaccatttgcagaaatggctgggattaaaattcga
aagtttgaatcggtaggcaatcaaaaggtcaagtttcgttttcgtttttttccgggaact
tgttctaaaatttgtgaaattttagaacctaccacagcggaagtttgggctcgttataca
gatggaaaaaaattctacaaaggaagtcccgtaatcactgcaaataattatcataaagga
aaagtcatttacgtaggatcttctttagaacccttaagttttgttcttctttatagacgt
attttaaaagaagcaaaaattccattcattttctacggacccaatgttgagaaaattttt
agatcgggaagaaaacaaaattatgaaatctttattaatcattccggaaagaaaagtctt
gcaggtttaaaaattttagatccttatgaagttagaattctttctaaaaagaaatga

DBGET integrated database retrieval system