KEGG   Leptospira interrogans serovar Lai 56601: LA_0057Help
Entry
LA_0057           CDS       T00098                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LA_0057 (folP)
Enzymes [BR:lil01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LA_0057 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:62364..63206
Genome map
AA seq 280 aa AA seqDB search
MESKQDSNSSSYSTKIFGVLNITEDSFSDGGKYLTFKSSSEKANSLLNQGADVIDIGAQS
SNIQASLIGPEIEWIRMKELISNLVAKGVRISVDSFQPQVIANSLSAGVEFINHIRGFVD
EESIREISKYARTNRKFILMYSHNHSNRAETKSHLTPNNVILEIVRFFRERKKILLNAGI
AQEQLIFDPGMGFFLSSDFQVSFEVLKKIKTLQEEFSPMMVSVTKKSFLGNALGGLKVEE
REIPTVIAELYLCIQNVEYIRTHEPKNLKQALKIWNLMNK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaacaagattcgaattcttcaagttattctacaaagatctttggggtattg
aatattaccgaagattcattttccgatggaggaaagtatcttacttttaaatcttcctct
gaaaaagcaaattctctgttaaaccaaggcgcagatgtaattgatataggcgctcagtct
tctaatattcaagcaagtttgatcggtcccgaaatcgaatggataagaatgaaggagtta
atttccaatttggttgcaaaaggagttcgtatttccgtagattcttttcaacctcaagta
attgctaattctttatctgcgggtgtggaatttattaatcatatccgaggctttgtagat
gaagaatctattcgagagatttccaaatatgccagaaccaatcgaaagtttattttgatg
tattctcataatcattccaatcgtgcggaaacaaaatcacatctaacaccaaataatgta
attttagaaattgtacggttttttcgtgaaagaaaaaaaattttattaaacgcgggaatt
gcacaagagcaattgatctttgatcctggaatgggtttttttctcagttctgattttcag
gtgagttttgaagtattaaaaaaaattaaaactctccaggaagagttttctccgatgatg
gtttcggttacaaaaaaatcatttttaggaaatgcgctcggaggtttgaaagtagaagaa
agagaaattcctaccgtaattgccgaactttatttatgtattcaaaatgtagaatatatc
cgaactcatgaacctaaaaatttaaaacaagctttgaaaatttggaatttaatgaataag
taa

DBGET integrated database retrieval system