KEGG   Leptospira interrogans serovar Lai 56601: LA_0325Help
Entry
LA_0325           CDS       T00098                                 

Gene name
adhP
Definition
Zn-dependent alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LA_0325 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA_0325 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    LA_0325 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LA_0325 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LA_0325 (adhP)
   00626 Naphthalene degradation
    LA_0325 (adhP)
Enzymes [BR:lil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LA_0325 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:322365..323387
Genome map
AA seq 340 aa AA seqDB search
MQRTIALVQKKGSLENISLETEALPEPNENEVQIEVHSIGLNFADLFAIQGLYSATPQGA
FIPGLEYSGVVISTGKKVKNVKKKDKIMGVTRFGGYSSHLNIDSRYVFKLPSKWNFDQGA
GFLVQGLTAYYALAALGDLKKGQTVLIHSAAGGVGILANRIAKKLGAFTIGTVGTSSKID
LLKKEGYDKQIVRSSRFKNDLQESLSGTDLNLVLECIGGKIFQESYEVMAPMGRMIVYGA
AEMMGEGSSVNWARIAYKYFSRPKLDPMKMVSDNKAVMGFNLIWLYEKVEILTKHLNALV
KLNISPPLIGKTFEFDNLNEALKYFQSGTSMGKVVLKVKS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaacgatcgcacttgtccaaaaaaaaggatctcttgaaaacataagtttagaa
acggaagctcttcccgagccgaatgaaaacgaagtacaaatcgaagttcattcaattgga
ttaaactttgcggatttatttgcaattcagggattgtatagcgctactccgcaaggagcc
tttattccaggacttgaatattcaggagtggtaatttctaccggaaaaaaagtcaaaaac
gtaaaaaagaaagataagattatgggagtcactcgttttggcggttattcttctcatttg
aatatagactccagatacgtttttaaacttccttccaagtggaactttgatcaaggagct
ggttttcttgttcaaggtttaaccgcttattacgcgttagctgctttgggggatcttaaa
aaaggacagacggttttgatccatagtgcggctggtggggtcggaattcttgcaaacaga
atcgccaaaaaattaggtgcgttcacgatcggaacggtaggaacttcttctaaaatcgat
cttcttaaaaaggaaggttatgacaaacaaattgttcgttccagtcgatttaaaaacgat
ctacaggaatctctttccggaacagatttaaatttagttttagaatgtatcggtggaaaa
atctttcaagaaagttacgaagttatggctccgatgggaagaatgatcgtctacggcgca
gcggagatgatgggtgaaggtagttctgtaaattgggcaagaattgcttataagtatttt
tccagaccgaaattagatccaatgaaaatggtttcagataataaagccgtgatgggattt
aatttgatttggctctatgaaaaggtagaaatattgacaaaacatctaaacgctcttgtg
aaattaaacatttctcctcctcttataggtaaaacttttgagtttgataatttaaacgag
gctctgaaatactttcaatccggtacgtctatgggcaaagtagttttaaaagttaaatct
taa

DBGET integrated database retrieval system