KEGG   Leptospira interrogans serovar Lai 56601: LA_0666Help
Entry
LA_0666           CDS       T00098                                 

Gene name
mauG
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lil  Leptospira interrogans serovar Lai 56601
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:668545..669567
Genome map
AA seq 340 aa AA seqDB search
MKPSTAGMFYLTFLGILLVTCGPSEKTKKLIDDSKKIFGTIPDKMPGGEVDTPELIQLGE
KLYFEKKLSANDTQSCNSCHNVVGKAAGVDNLPTSPGAFGKNGVRNSPTVLNAGFHIAQF
WDGRAKDLKEQAKGPILNPVEMAMPSASEVEKKIGQIPEYQELFAKAYPDSLTKENSNTL
TRAQKITYDNITGAIAAFERTLKTQDRFDDFQKGNHKALSIEEQEGLEKFITTGCITCHV
GPLLGGNSFRKLGQINPYENSSDKGRQDLTKNSSDAFVFKVPSLRNVAITGPYFHDGKIT
TLEEAVKKMAHLQLGKDLSDSDTKLIVTFLKTLTDKNRSN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatctacagcggggatgttctatttaacgtttctaggaattcttttggtaact
tgtggcccgtctgagaagacgaaaaaactgatcgatgattccaaaaagattttcggaacc
attccggataaaatgccaggtggggaggtggacactcccgaattgattcagttaggcgaa
aagttatattttgaaaagaaactttctgcaaatgatacacagtcttgtaattcttgtcat
aacgttgttggaaaagctgctggggtcgataatcttcctacgtctccgggtgcatttgga
aaaaatggagtcagaaattctccgaccgttttgaatgctgggtttcatatcgctcagttt
tgggatggtagagccaaggatctgaaagaacaagccaagggaccaattttaaatccggtg
gaaatggctatgccttctgcatcagaagtagaaaagaaaatcggtcaaattccggaatac
caagaactttttgcaaaggcttatcctgactctttaacaaaagaaaattctaatactctt
actagagcacaaaagatcacttatgataatatcaccggggcgattgctgcttttgaaaga
actttaaaaacccaagaccgttttgatgattttcaaaaaggaaatcataaagctctttct
atagaagagcaggaaggtttagaaaagtttataacaactggttgtattacttgtcacgtt
ggtcctcttttaggtgggaattcttttcgtaaactgggccagataaatccttatgaaaat
tcttccgataaaggtcgtcaagatctgactaagaactcttcggacgcttttgtgtttaag
gttccatcattacgaaatgtggcgattaccgggccttattttcacgatggaaaaattaca
actttggaagaagcagtcaaaaaaatggctcatcttcaacttggaaaagatctttcggat
tctgatacaaagttgatcgtaactttcctgaagacgttgaccgataagaaccggtctaat
taa

DBGET integrated database retrieval system