KEGG   Leptospira interrogans serovar Lai 56601: LA_0778Help
Entry
LA_0778           CDS       T00098                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lil00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lil00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(788128..789090)
Genome map
AA seq 320 aa AA seqDB search
MSKGSFFTFCRLMYYNHKNVLDTEQFSKPDLDFLIGKIRVMERLVEQNKAFGILTGKLLA
SLFFEASTRTRLSFEAAMERLGGRVISTVGFQFSSISKGETLYDTMKMVEAYADIAVIRH
PVEGSSRIAAGAVKIPVINAGDGAGQHPTQAILDLYTIISEKGTLDGLTVAFIGDLKYGR
TIHSLINLLRHYKVRLFLISPPELALPESYKKALQGYSLTLEETTDIKAVWDCDVAYVTR
IQEERFPDHKEYERLKDLFKINKELILASKKETTVLHPLPRVNELSTDVDDLPNAAYFRQ
ARYGVVSRMTLLCLSLGQDF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaaagggagtttttttacattctgtcgtttaatgtactataatcataaaaatgta
ttagatacggaacagttctcaaaaccagatcttgattttctcattgggaaaattagagtc
atggaacgtcttgtagaacagaacaaggcatttggaattcttaccggcaaacttttagca
tctcttttttttgaagcctctacaagaaccagactttctttcgaagcggctatggaacgt
ttaggaggaagagtaatctccacggtgggatttcaattttcttccatttccaaaggagaa
acgttatacgacactatgaagatggtggaagcttacgcagatattgctgtcattagacat
cctgtagaaggttcttccagaatcgcagcaggagcggtaaaaatcccagtcatcaacgct
ggagacggagcgggacaacatcccactcaagcaattttagatctttacacgatcatttcc
gaaaaaggaacgttagacggtttgacggttgcgtttataggtgacttaaaatacggaaga
acgatccattctcttatcaatttactcagacactataaggttcgtttatttctgatttct
cctcctgaactcgctttaccagaatcttataaaaaagctttacaaggttattctcttact
ctggaagaaacgacagacatcaaagcagtttgggattgtgacgtagcttatgtgactaga
attcaagaagaaagatttccagatcataaagaatacgaaagacttaaggatctttttaag
attaacaaagaattaattcttgcttccaaaaaagaaactacagttctccatcctcttcct
agggtgaacgaactttccacggacgtagatgatctaccgaacgcggcttattttagacaa
gcaagatacggtgttgtaagtcgtatgactcttctttgtctttctttaggacaggatttc
taa

DBGET integrated database retrieval system