KEGG   Leptospira interrogans serovar Lai 56601: LA_0853Help
Entry
LA_0853           CDS       T00098                                 

Gene name
proB
Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00330  Arginine and proline metabolism
lil00332  Carbapenem biosynthesis
lil01100  Metabolic pathways
lil01130  Biosynthesis of antibiotics
lil01230  Biosynthesis of amino acids
Module
lil_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LA_0853 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LA_0853 (proB)
Enzymes [BR:lil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LA_0853 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-GeneID: 1150196
NCBI-ProteinID: NP_711034
UniProt: P94871
Position
I:851443..852315
Genome map
AA seq 290 aa AA seqDB search
MKPERNSLSEKIRNAEKIVIKVGSARLSGLPSEVNDFLFQLVSDIRHLRDLGKKVILVSS
GAIARGRLLLSELPSTISSGDSLAEKQALAAMGQNRLVNLYDSFFSKVNLSIAQILFGVL
DLESKEGYKNLKNTFTQLVEWGILPVVNENDSVATEEVKFGDNDMLSALVSLIVEADLLI
ILTGVDGFLKEEKVVPFLEKISKEDLGLAGGPSGPGTGGMFTKLKSAGLLSEAGIPTAIL
NGKKMHVIREFLEKNSIGTLVAPSGNRVFSEEDVKEIIRKNRNGNGGNSL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggaacgaaactcactttctgaaaagatccgtaacgctgaaaagatcgttatc
aaagtaggttcggcaaggctttctggacttccgtcggaagtaaacgattttctatttcaa
ttggtaagtgatattcgtcatcttagagatttaggaaaaaaggtgattttagtctcttca
ggagcgattgcaagaggaagacttttgttaagcgaacttccctctacaatttcttcgggg
gattcacttgccgaaaaacaagcgttagccgcaatggggcaaaataggcttgtcaatctc
tacgatagttttttttccaaagtcaatttgagcatcgcacagatcctttttggtgttttg
gatttggaatccaaagaaggttataaaaatctaaagaacacatttactcaacttgtagaa
tgggggatacttccagtagttaacgaaaatgattccgttgcaaccgaagaagtaaagttt
ggagacaacgatatgctttccgctttggtgagtttgatcgtagaagccgatcttttgatt
atacttacaggtgtggatggttttttaaaagaagagaaagttgtaccttttctggagaaa
atttctaaagaagatttaggtcttgctgggggtcctagtggacctggcacaggcggaatg
ttcactaaacttaaatctgcgggtttattatctgaggctggaattccgaccgcgatctta
aacggaaaaaaaatgcatgtgattcgtgaatttttagaaaaaaattcaataggaacatta
gttgctccttccggaaaccgcgttttttctgaagaggacgtaaaagaaatcatccgtaaa
aatagaaacggaaacggaggaaatagtttatga

DBGET integrated database retrieval system