KEGG   Leptospira interrogans serovar Lai 56601: LA_0967Help
Entry
LA_0967           CDS       T00098                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lil00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LA_0967
Enzymes [BR:lil01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LA_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:973130..974968
Genome map
AA seq 612 aa AA seqDB search
MIFIEKLRTDILELIQSSEFEKKKLIKVSEEDSNYILEILNSIWEATQEGSLCVPVKQEW
KKILKIKLPGLVVDRFENTEWVYFEKTYHSKIELERLLKERIENNVSVNVDTDRVEKILK
DLESKSFSLKKNQKKTIFSCLNSSFQIISGGPGTGKTTVVAFLLQILNELKQLPSPEKIA
LVAPTGRAAQRLTESVQENLKKISTSLENGFLRGQTIHGLLNYKQSLGGFYYNRERYLPH
RLIIVDEVSMVDLDLMLSLWNSIPKNETIQEGTIPFRFILIGDPHQLPSVEKGAVLSDFL
SVLESKRFHFVSKLEESNRQQPNTNGEVSKIVTLAEEILKYSPENLNLGTKIDESFPKTN
QIKENILYKSEVVWLQNIESSTSDYFSRDELVEKLWKEIFYPQIDRISSWKIQDSFCFDK
PDFIQKFQEELKRFRCLTIFRSGYWGVDAIQTKIMNLAAQNLFFGKGGNFFAKRLSKGIY
FVGLPILITRNDKSRKLFNGDIGIVLKTESTGELRAVFPIEGKLFQFALDTLPEHEPAFV
MSVHKSQGSEYDTILIYLPDSIEEEKSNGLLNRQVLYTAITRAKKQVILAGNPQTWEIGI
ANFQNRNTGFRI
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
ttgatttttattgaaaaactaaggacggatattttagaactgattcagtcatcggaattc
gaaaagaaaaaattaataaaagtatcagaagaggactctaattatatattagaaatattg
aattcaatttgggaggctactcaggaaggaagtttatgtgttcctgtaaaacaagaatgg
aagaaaattttaaaaataaaactccccggtcttgtcgtagatcggtttgaaaatacggaa
tgggtgtattttgaaaaaacgtatcattctaaaattgaattggaacgtcttttaaaagaa
agaatcgaaaataatgtttcggttaatgtggatacggatcgagttgaaaaaattctaaag
gatctggaatcgaaaagtttttcactgaaaaaaaatcaaaaaaaaacaatcttttcttgt
ttaaactcctctttccaaattataagtggaggacctggtactggaaaaacaaccgtagta
gcgtttttattacaaattttgaatgaactaaagcaacttccttctccagaaaaaattgca
cttgttgcaccgactggaagggcggctcagaggttaacggaatcggttcaagaaaattta
aaaaaaatctccacgtctctcgaaaatggatttctaagaggacaaacgattcacggactt
ttaaactacaaacagtcgttaggtgggttttattataatcgagaaagataccttccacat
agactaattatcgtggacgaagtttctatggtagatttggatctgatgctttctctttgg
aattcaattcctaaaaatgagacgattcaagaaggaaccattccgtttcggtttatattg
attggagatccgcatcaacttccttctgtagaaaaaggtgccgtgttaagcgatttttta
tccgtgttagaatctaaacgatttcattttgtttctaaattagaagaaagtaatcgtcag
caaccaaatacaaacggagaagtttcaaagatagtcacactcgcagaagaaattttaaaa
tattctcctgaaaatctaaacttaggaactaagatagatgaaagttttccaaaaacgaat
caaattaaagagaatattttatacaaaagtgaagttgtatggttgcaaaatattgaaagt
agcacttccgattatttttctagagatgagttagttgaaaaactttggaaagaaattttt
tatcctcaaattgatagaatctcttcttggaaaattcaggattctttttgttttgataaa
ccagattttattcaaaaatttcaagaggaactaaaacgatttcgttgtcttacgattttt
aggagtggctattggggagtggatgcgattcaaacaaagatcatgaatttggctgctcaa
aatcttttttttggaaagggcgggaacttttttgccaaacgactttccaagggaatttat
tttgtaggtcttcccattttaattactcgaaacgataaaagtagaaaactttttaacgga
gatattggaatcgtattaaaaacggaatctaccggagaacttagggcggtgtttccgatt
gaaggaaaactttttcagtttgcgttagacactcttccagaacatgaacctgcgtttgta
atgagtgtacataaaagtcaaggatcagaatatgatacaatcctaatttatcttccagat
tctatagaagaggaaaaatctaatgggttactcaatcgtcaagttctttatacagcaatt
acaagagctaaaaaacaagtgatcttggctggaaatccgcaaacctgggaaattggaatc
gccaattttcaaaatagaaatactgggtttagaatttaa

DBGET integrated database retrieval system