KEGG   Leptospira interrogans serovar Lai 56601: LA_1007Help
Entry
LA_1007           CDS       T00098                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lil00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lil00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1013237..1013806
Genome map
AA seq 189 aa AA seqDB search
MKEGASFMYSKYFIWFMTLGIFLPLAGIFAKGSFYDFKVKDIKGNEVSLSKYKGKVVMVV
NVASKCGYTYQYEHLEKVYKKYKDQGFAVVGFPANNFGGQEPGTDQEIETFCRIQKGASF
DMMSKISVKGKDIHPLYSYLIQNSPNPGEVEWNFEKILISKNGTIEARYRSSVEPDSSAV
TQKIETLLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaggagccagttttatgtattcaaagtatttcatttggtttatgactttagga
atttttttaccattagcggggatttttgcaaagggaagtttttatgatttcaaagtaaaa
gacatcaaaggaaacgaagtgtctctttctaaatataagggaaaggtagtgatggtggtg
aacgtagcttctaaatgtggttatacctatcaatacgaacatctcgaaaaagtttataaa
aaatataaggatcaaggatttgcagtagtaggttttcccgctaataattttggaggccaa
gaaccaggaaccgatcaagaaatcgaaacgttttgcagaattcaaaaaggtgcaagtttt
gatatgatgtctaaaatttcagtcaaaggaaaggatattcatcctttatattcttatctg
attcaaaattctccaaatccgggagaagtagaatggaatttcgaaaaaattttaatatca
aaaaatggaacaatagaagcgagataccgttcttctgttgagcctgatagttccgcagtg
actcaaaaaattgagactctcttaaagtga

DBGET integrated database retrieval system