KEGG   Leptospira interrogans serovar Lai 56601: LA_1102Help
Entry
LA_1102           CDS       T00098                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00020  Citrate cycle (TCA cycle)
lil00640  Propanoate metabolism
lil00660  C5-Branched dibasic acid metabolism
lil01100  Metabolic pathways
lil01110  Biosynthesis of secondary metabolites
lil01120  Microbial metabolism in diverse environments
lil01130  Biosynthesis of antibiotics
lil01200  Carbon metabolism
Module
lil_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lil_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LA_1102 (sucC)
   00640 Propanoate metabolism
    LA_1102 (sucC)
   00660 C5-Branched dibasic acid metabolism
    LA_1102 (sucC)
Enzymes [BR:lil01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LA_1102 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA GARS_A
Motif
Other DBs
NCBI-GeneID: 1150445
NCBI-ProteinID: NP_711283
UniProt: Q8F746
Position
I:complement(1103953..1105125)
Genome map
AA seq 390 aa AA seqDB search
MKIHEYQAKEILRRHKANVPFGVVIDKKENASKAHDEVTSKTGGSVVVVKAQIHAGGRGK
GGGVKVTKTKEDAIAAVDKILGMQLITPQTGPEGKKVLKVYLEQGIDIAKEYYLSILLDR
SIRKTIIMASTEGGMEIEEVAETHPEKILKIAIDPGIGLQVNQARQLAFELGLPAESHKS
FQSLLAAIYEAYIKEDASLLEINPLILTKQNEIIAGDCKIDLDENALYRHADNAAFRDIT
EEDPLEVQASEFNLNYVKLDGNIGCMVNGAGLAMATMDIVKLAGAEPANFLDVGGGANKT
TVTNGFKIILGDPNVKGIFVNIFGGIVRCDMVAEGIIEAAKAVDLKVPLVVRLQGTNSEL
GREVLNKSGLKITGVDDLREAASTIAKLIG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgagtatcaggcaaaagaaatcctgagaaggcataaagccaacgttcct
tttggagtcgtaattgataaaaaagaaaacgcttccaaagcccatgacgaagttacctct
aaaacaggtggttccgtcgtagtcgtaaaagctcaaattcacgccggagggcggggaaaa
ggtggcggagtcaaggtaactaaaaccaaagaagacgcgatcgcagccgtagataaaatc
ttaggtatgcagctcatcactcctcaaaccggaccggaaggaaaaaaagtccttaaagta
tatctggaacaaggaatcgacattgctaaagaatactatctgagcatactactcgatcgt
tccatccgcaaaaccatcattatggcatctacagaaggtggaatggaaatcgaagaagta
gcggaaactcatccggaaaagattctaaaaattgcaatcgatcctggaatcggactccaa
gtaaatcaagccagacagcttgcatttgaacttggactacctgcagaatctcacaaatct
ttccaaagtcttctcgcggcgatttacgaagcttatatcaaagaagatgcttctctgtta
gaaatcaatccactgattctcacaaaacaaaatgaaatcatcgctggagattgtaagata
gatttagacgaaaacgctctctacagacacgcggacaacgcggcctttagagacatcacc
gaagaagatcctctcgaagttcaggcttccgagtttaacctcaactacgtcaagttagac
ggaaacataggttgtatggtcaacggagcgggactcgctatggcgacgatggacatcgta
aaactcgcaggtgcagaacctgccaacttcttggatgtaggtggtggagccaacaaaacc
acagtaaccaacggattcaaaattattttaggagatccaaacgtaaaaggaatcttcgta
aatatttttggtggaattgttcgttgtgacatggtcgccgaaggaattatagaagcagca
aaagcagtggatctcaaagttcctcttgtggttcgtcttcaaggtaccaactcggaacta
ggaagagaagtgctcaacaaaagcggactaaaaattaccggagtagacgatctccgagaa
gcggcaagcaccattgccaaactgattgggtaa

DBGET integrated database retrieval system