KEGG   Leptospira interrogans serovar Lai 56601: LA_1222Help
Entry
LA_1222           CDS       T00098                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00020  Citrate cycle (TCA cycle)
lil00310  Lysine degradation
lil01100  Metabolic pathways
lil01110  Biosynthesis of secondary metabolites
lil01120  Microbial metabolism in diverse environments
lil01130  Biosynthesis of antibiotics
lil01200  Carbon metabolism
Module
lil_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lil_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LA_1222 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    LA_1222 (aceF)
Enzymes [BR:lil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LA_1222 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 1150565
NCBI-ProteinID: NP_711403
UniProt: Q8F6S9
Position
I:1224215..1225474
Genome map
AA seq 419 aa AA seqDB search
MSVEIKVPEMGESITEATIANWVKKEGESVKQDEILLELETDKATMEVPAPSSGVLQKIH
KKAGETVKVKEIIGLIDSSATASSPSTSAPTNSAQTTQTSGNGTINETLPPAVRKLIEDN
GLNPASITGSGKNGQITKEDVLKAIETKATSSVSNASVNVGTPAAVKATLTLPEIPKAVP
AARRTDLPRENVVPMTRLRKVIAERLVSAQHNAAILTTFNEVDMSAVMELRNRYKDKFKE
AHNVSLGFMSFFTKAAIHALKTIPAINAEIRGSDIVYKNYYDIGVAVGGPKGLVVPVVRD
ADLLSFAGVEQEIIRLANRVKDGKIELAEMEGGTFTISNGGIYGSMMSTPILNPPQSGIL
GLHNIVKRAVVVNDQIVIRPMMYLALSYDHRIVDGKEAVTFLVKVKEAIEDPSRLLLEL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaaattaaggtccccgaaatgggggaatccattacggaagctacgattgca
aactgggtaaagaaagaaggagaatctgtaaaacaagacgagatcttgttagaactggaa
accgataaggcgaccatggaagttccggctccttcttcgggtgttcttcagaaaattcat
aaaaaggctggagaaaccgtaaaagtaaaggagatcatcggactgattgactcttcagca
actgcttcttctccttccacttctgctccaacaaattcagcacaaacgactcaaacatca
ggaaacggaaccataaacgaaactcttccgcctgcggtccgtaagttgatcgaagacaac
ggactcaatccggcatcgattactggttccggtaaaaacggacaaatcacaaaagaagac
gtattaaaagcaatcgaaacaaaagcgacgtcgtcagtttcaaacgcttccgtaaatgta
ggaactccagcggctgtcaaagcgacgctgactttacctgaaattccgaaagcggttccg
gctgcgagaagaacggatctaccaagagaaaacgtagttcctatgactcgacttcgtaag
gtaattgcagaaagacttgtatcggcacaacacaacgctgcaattctgaccacgtttaac
gaagtagatatgagtgccgtaatggaactcagaaatcgatataaggataaatttaaagaa
gcgcataacgtaagtcttggatttatgagcttttttactaaggctgcgatccatgcgcta
aaaacaattccggcgatcaatgcagaaatccgtggaagtgatattgtttacaaaaattat
tatgacataggggtcgctgttggaggaccgaagggactggtcgttcctgtcgtaagagac
gcggacttgctcagttttgcaggagtagaacaagagattataagacttgcgaatcgggtc
aaagacgggaaaattgaacttgctgaaatggaaggtgggacgtttacgatttccaatggg
ggaatctacggttctatgatgtccactccaattctcaatcccccacaaagtggaatttta
ggacttcataatatagtaaaacgtgctgtggtggtaaacgatcagatcgtgattcgtccg
atgatgtatcttgcactttcctacgatcatagaattgtagatggaaaagaggcggtcact
ttccttgtaaaggttaaggaagcgatcgaagatccaagtcggcttttactagaactttaa

DBGET integrated database retrieval system