KEGG   Leptospira interrogans serovar Lai 56601: LA_1437Help
Entry
LA_1437           CDS       T00098                                 

Gene name
nagC
Definition
(RefSeq) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00010  Glycolysis / Gluconeogenesis
lil00052  Galactose metabolism
lil00500  Starch and sucrose metabolism
lil00520  Amino sugar and nucleotide sugar metabolism
lil00521  Streptomycin biosynthesis
lil01100  Metabolic pathways
lil01110  Biosynthesis of secondary metabolites
lil01120  Microbial metabolism in diverse environments
lil01130  Biosynthesis of antibiotics
lil01200  Carbon metabolism
Module
lil_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA_1437 (nagC)
   00052 Galactose metabolism
    LA_1437 (nagC)
   00500 Starch and sucrose metabolism
    LA_1437 (nagC)
   00520 Amino sugar and nucleotide sugar metabolism
    LA_1437 (nagC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LA_1437 (nagC)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LA_1437 (nagC)
Enzymes [BR:lil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LA_1437 (nagC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG DEDD_Tnp_IS110 FGGY_N SpoVAE Glucokinase
Motif
Other DBs
NCBI-GeneID: 1150780
NCBI-ProteinID: NP_711618
UniProt: Q8F672
Position
I:complement(1438799..1439695)
Genome map
AA seq 298 aa AA seqDB search
MKSFLGIDIGAGSIKASLIDSNGNVLKSSFRKTGAETNEKQFLDSICDIVSEMKNSSLTA
VGIGSPGPIDSENGILIESANLPLLKNVTLVSHLKEKFSIPVYYNNDANLAALGEYHFGL
GKGSPNLVILTLGTGLGGGWVYQGKLFNGYKGSGMEAGHVTYLPNGSLCGCGQRGCTEAY
FSASGFLNRYKEKTGEVLDSAEEFFEKTRKGDKTASILLNEGIDALAQLCRNLIHTINPE
KIVFTGGLVKSWDLFGDSLQNRIRELIFPIFRTYTQILPGGNVSGTLGAAALCMENLE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctttcttggaatcgatataggtgcaggaagtatcaaagcaagtctcatcgat
tccaacggaaacgtactgaaaagttctttccgtaaaaccggcgcggaaacaaacgaaaaa
caattcctagattctatttgtgacatcgtatcagaaatgaaaaactcttctttaacggcg
gtgggcataggaagcccagggccaatcgattctgaaaacggaattttgatcgagtccgct
aatcttcctcttttaaaaaatgtgacgttagtctctcatttaaaagaaaaattttctatt
ccagtatattataataatgatgcaaaccttgctgcgttgggagaataccatttcggttta
ggaaaaggatcgcctaatttggtaattttaaccttaggaaccggattaggaggtggttgg
gtatatcaaggaaaactttttaacggttacaaaggaagtggaatggaagcgggacacgtt
acgtatcttccaaacggctctctatgcggttgtggtcaaagaggttgcaccgaagcttat
tttagcgccagcggatttttaaatcgatataaagaaaagaccggagaagttttagattcc
gcagaagaattctttgaaaaaactagaaaaggagataaaaccgcatcgattttgttaaac
gaaggtattgacgcgcttgcacaactttgtagaaatctaattcatacaatcaacccggag
aaaattgtttttacaggaggacttgtaaagtcctgggatttattcggtgattccctacaa
aatagaatccgggaactgatctttccaattttcagaacttatactcaaatcctccccgga
ggaaacgtatccggcacattaggcgctgcggcgctttgtatggagaatttagaatga

DBGET integrated database retrieval system