KEGG   Leptospira interrogans serovar Lai 56601: LA_1437Help
Entry
LA_1437           CDS       T00098                                 

Gene name
nagC
Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LA_1437 (nagC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA_1437 (nagC)
   00052 Galactose metabolism
    LA_1437 (nagC)
   00500 Starch and sucrose metabolism
    LA_1437 (nagC)
   00520 Amino sugar and nucleotide sugar metabolism
    LA_1437 (nagC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LA_1437 (nagC)
   00524 Butirosin and neomycin biosynthesis
    LA_1437 (nagC)
Enzymes [BR:lil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LA_1437 (nagC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1438799..1439695)
Genome map
AA seq 298 aa AA seqDB search
MKSFLGIDIGAGSIKASLIDSNGNVLKSSFRKTGAETNEKQFLDSICDIVSEMKNSSLTA
VGIGSPGPIDSENGILIESANLPLLKNVTLVSHLKEKFSIPVYYNNDANLAALGEYHFGL
GKGSPNLVILTLGTGLGGGWVYQGKLFNGYKGSGMEAGHVTYLPNGSLCGCGQRGCTEAY
FSASGFLNRYKEKTGEVLDSAEEFFEKTRKGDKTASILLNEGIDALAQLCRNLIHTINPE
KIVFTGGLVKSWDLFGDSLQNRIRELIFPIFRTYTQILPGGNVSGTLGAAALCMENLE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctttcttggaatcgatataggtgcaggaagtatcaaagcaagtctcatcgat
tccaacggaaacgtactgaaaagttctttccgtaaaaccggcgcggaaacaaacgaaaaa
caattcctagattctatttgtgacatcgtatcagaaatgaaaaactcttctttaacggcg
gtgggcataggaagcccagggccaatcgattctgaaaacggaattttgatcgagtccgct
aatcttcctcttttaaaaaatgtgacgttagtctctcatttaaaagaaaaattttctatt
ccagtatattataataatgatgcaaaccttgctgcgttgggagaataccatttcggttta
ggaaaaggatcgcctaatttggtaattttaaccttaggaaccggattaggaggtggttgg
gtatatcaaggaaaactttttaacggttacaaaggaagtggaatggaagcgggacacgtt
acgtatcttccaaacggctctctatgcggttgtggtcaaagaggttgcaccgaagcttat
tttagcgccagcggatttttaaatcgatataaagaaaagaccggagaagttttagattcc
gcagaagaattctttgaaaaaactagaaaaggagataaaaccgcatcgattttgttaaac
gaaggtattgacgcgcttgcacaactttgtagaaatctaattcatacaatcaacccggag
aaaattgtttttacaggaggacttgtaaagtcctgggatttattcggtgattccctacaa
aatagaatccgggaactgatctttccaattttcagaacttatactcaaatcctccccgga
ggaaacgtatccggcacattaggcgctgcggcgctttgtatggagaatttagaatga

DBGET integrated database retrieval system