KEGG   Leptospira interrogans serovar Lai 56601: LA_1616Help
Entry
LA_1616           CDS       T00098                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K19714  
3-deoxy-alpha-D-manno-octulosonate 8-oxidase [EC:1.1.3.48]
Organism
lil  Leptospira interrogans serovar Lai 56601
Brite
Enzymes [BR:lil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.48  3-deoxy-alpha-D-manno-octulosonate 8-oxidase
     LA_1616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1610420..1611487
Genome map
AA seq 355 aa AA seqDB search
MTSLRIFKQVPRLLFGFNTIDRINELLPKKNNGDYYIFIIDDVHQKGTIHSRLKHASEDM
IEWFPASVKEPSTLQIDNLRDKFMQARDHKLPKAIVGIGGGSTMDVAKALSVMMCNEGSA
SQYQGWDLVPNPGIYKIGIPTVAGSGAEASRTAVLMGKERKFGINSDHSMFDAIILDSSL
IKNVPIAQRFYSGMDCYIHCVESLQGTMINELAKGNASKALELCEKVFLSDGDDDMLLTA
SYMGGVSIVNSEVGVCHALSYGLSLELGYRHGFANCVAFNVLDEYYGPWVDRFREMLKIH
KIELPKNVCRSLDEAAMQRMVNMTLKMERPLTNALGENWKDKMTPNKIVSLYERM
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgacctctcttagaatttttaaacaagtaccacgtttacttttcggcttcaatacaatc
gatcgaataaatgaattattgcctaaaaaaaataacggagattattatatttttataata
gacgatgttcatcaaaaaggaactatacatagtcgattgaaacacgcgagcgaagatatg
attgaatggtttcctgcaagtgtaaaggagccttcgacgttgcagatcgataatttaagg
gataagtttatgcaagcccgagatcataaactaccgaaagcgatcgtggggatcggcggt
ggtagcactatggatgtggctaaggcattgtccgtaatgatgtgtaatgaaggctccgcc
tctcagtaccaaggatgggatcttgtgccaaatcctggaatctataagattggaattcca
accgtagcgggttctggggcagaggctagtcgtactgctgtgctaatgggtaaagaacgt
aaattcgggattaatagtgatcatagtatgtttgatgcaattatattagatagttcctta
ataaagaatgtcccaatagctcaaagattttattcgggtatggattgttatattcattgt
gtggagagtttacaaggaacaatgatcaatgaattagcgaaaggtaatgcaagcaaagcg
ttggaactttgtgagaaagtttttttatcggatggcgatgacgatatgttgcttacggct
tcctatatgggcggggtatccattgtgaattccgaagttggcgtttgtcatgccttatcc
tacgggcttagtcttgaattgggatacaggcatggttttgcgaattgtgtcgcattcaat
gttttagatgaatattacggaccttgggtggatcgctttcgggaaatgttaaaaattcat
aaaatcgaattaccaaaaaatgtctgtagatctttggatgaagctgcgatgcaacgtatg
gtgaatatgactcttaaaatggaaagacctcttacgaatgcacttggcgagaattggaaa
gataagatgacaccgaataaaatagttagcttatacgagagaatgtaa

DBGET integrated database retrieval system