KEGG   Leptospira interrogans serovar Lai 56601: LA_1633Help
Entry
LA_1633           CDS       T00098                                 

Definition
dTDP-4-dehydrorhamnose epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LA_1633
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LA_1633
Enzymes [BR:lil01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LA_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1629016..1629468
Genome map
AA seq 150 aa AA seqDB search
MNKVLLEGVVITSLKEIFDPRGSVLHMIRIDDPEYNGFGECYFSEINPRAVKAWKFHKKQ
TQNFTVPSGRIKLILFDPRENSKTKGKIQEIILGRPENYQRVKIPPQIWYGFTCISKEKA
LIANFTDIPHDPSEAERLPEHGSFIPFTWG
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagttcttttagaaggcgtagtaattacttcgttgaaagaaatattcgatcca
agaggatccgtactacatatgattcgtatcgatgatcccgaatacaatggattcggagaa
tgttatttttcggagattaatcctcgtgctgtaaaggcctggaagtttcataaaaaacaa
acgcaaaattttacggttccctctggtaggatcaaattgatactttttgatcctagagaa
aattcaaaaacaaagggaaaaattcaggaaatcattttaggaaggccagaaaattatcaa
agagttaaaatccctcctcaaatttggtacggttttacctgtatttctaaggaaaaagcg
ctcattgcaaattttaccgacatacctcatgatccatccgaagctgagcgtttgccagaa
catggttcattcattccatttacttggggctag

DBGET integrated database retrieval system