KEGG   Leptospira interrogans serovar Lai 56601: LA_1696Help
Entry
LA_1696           CDS       T00098                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LA_1696 (tpiA)
   01230 Biosynthesis of amino acids
    LA_1696 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA_1696 (tpiA)
   00051 Fructose and mannose metabolism
    LA_1696 (tpiA)
   00562 Inositol phosphate metabolism
    LA_1696 (tpiA)
Enzymes [BR:lil01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LA_1696 (tpiA)
Exosome [BR:lil04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LA_1696 (tpiA)
  Exosomal proteins of bladder cancer cells
   LA_1696 (tpiA)
  Exosomal proteins of melanoma cells
   LA_1696 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1694214..1694966)
Genome map
AA seq 250 aa AA seqDB search
MRKTIIAGNWKMNLSLKEAVFLAHSIREKIPSISKDKVSMVFPSTLHLENVSKILEGSSV
IVGAQNCYHSGLAAFTGETSPDQLKEIGVKVVMVGHSERRQFLGESNFFCNDKIRFLLKN
EFTVLYCVGETLSERESGKTLEVLSSQIREGLKGIDSVFFSNLILAYEPVWAIGTGKVAT
PSQAQEVHSFIRKEISGLFVGASSISESISILYGGSVKPDNIQDLLKEKDIDGGLVGGAS
QKISSFAELF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagacaattattgcaggaaactggaaaatgaatttatctcttaaagaagccgtt
ttcctagcacattcgatccgagaaaaaattccatccatttctaaagataaagtctcgatg
gtatttccttctactcttcatcttgaaaacgtttccaaaatattagaaggtagcagtgta
attgttggagcccaaaactgttatcactccggacttgcagcttttaccggcgaaacctct
cccgatcaactgaaagaaattggtgttaaagttgtaatggtcggtcattcggaacgtcgt
caatttttaggagagtctaactttttttgtaacgataaaatccgttttcttttaaagaac
gaatttacagtcctttattgtgttggagaaactctctccgaaagagaatccggtaaaaca
ttggaagtactgtcttctcaaattagagaaggtttaaaaggaattgatagcgtatttttt
tccaatttaattctggcttatgaaccagtttgggccattggaactggaaaagttgccacc
ccctctcaagcccaagaagtacattcttttattcgtaaagaaatttctggtctttttgta
ggcgcctcttctatttcagaatccatttctattctctacggtggttctgtaaaaccagac
aatattcaagatctattaaaagaaaaagatatagatgggggtttagttggaggagccagc
caaaaaatcagttccttcgctgaacttttctaa

DBGET integrated database retrieval system