KEGG   Leptospira interrogans serovar Lai 56601: LA_1744Help
Entry
LA_1744           CDS       T00098                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:lil02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:lil02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1733589..1734119
Genome map
AA seq 176 aa AA seqDB search
MKTILPTLPTQFGIPIVIVQHIGARSDGEWFRILEKLCNIKIKEAEEKEEIKSGMVYVAP
PNYHLLIEKDKTFSFSIGERVNFSRPSIDVLFETASEVYEDKLIGVILTGANSDGAQGLK
KIKENGGLAVVQDPLTAEIALMPRSAIEATSVDYVLSLEKIAELFIRLDQNNLEQR
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatattgccaactttacccactcaatttggaattcctattgtgattgttcaa
catataggagcgcgttctgatggagaatggtttcgaattttggaaaaattatgcaatatc
aaaatcaaagaggcagaggaaaaagaggaaataaaatcgggtatggtatatgtagcaccg
cctaactatcatttattgattgaaaaggataaaacattttctttttccataggagaacga
gtgaacttctcaagaccgtctattgatgttttatttgaaactgcttctgaagtatatgaa
gataaactaatcggagttatactgacgggcgcaaattctgacggcgcccagggtttaaaa
aaaattaaagaaaacggcggtttggcggttgttcaagatcctttaaccgctgagattgct
ttgatgcctagatccgctattgaagctacgtcagtggattatgtactttctttagaaaag
atcgctgaattattcataagactggatcaaaataacctggagcaaagatga

DBGET integrated database retrieval system