KEGG   Leptospira interrogans serovar Lai 56601: LA_2119Help
Entry
LA_2119           CDS       T00098                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LA_2119 (glpK)
Enzymes [BR:lil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LA_2119 (glpK)
Exosome [BR:lil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA_2119 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2088569..2090059
Genome map
AA seq 496 aa AA seqDB search
MSDYIIGIDAGTTGIRIFCFNKSGNVISSAYSEFNQHYPKPGWVEHDAEEIWAKTEKLIL
KAIRNGKLSPSKAVAIGITNQRETTVLFDKDTGKPVYNAIVWQCRRTSETCMDLKSKGLE
SFFRKKTGLVLDAYFSGTKIQWILENVKGVKARAEKGKIFFGTIDTYLLYRLTNGKSHKT
DHTNASRTLIYNIEKKEWDKELTQILGIPDSILPETHNSSSLFGRTEKVKGLPDGIPISS
LVGDQQGALFGQLCTEPGEAKNTYGTGCFLLFNTGNNFQISKNNLLTTLGCGPEGKTVYC
LEGSVFIGGAVVQFLRDNLKFFKESKISEKYASSVKKEDDVVFIPAFAGLGAPYWDMNAR
GAILGLTRDTTAEQITRAALKSIALQSYELVEAMENDTGSKLKVLKVDGGATGNSWLMQY
QSDILGKRVVRPSNVDTTVLGAAFLAGLERGFFPSVVDLKKKLKTSKEFSPQMKQPQREK
EIQIWKDSVHRIRTNQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattatatcatcggtatagacgccggaactaccgggattcgaattttttgtttt
aataaatcaggaaacgtaatttccagcgcgtattccgaatttaaccagcattatccgaaa
cctggttgggtggaacacgatgcggaagaaatctgggccaaaactgaaaagctcatatta
aaagcgattcgaaatggaaagttgagtccttctaaagcagtcgcaattggaattacaaat
caaagagaaaccacagtattgtttgataaagataccggaaaacctgtttataatgcgatc
gtatggcaatgtagaagaacttctgaaacctgtatggatcttaaatctaaaggattggaa
tctttttttcgtaaaaaaacgggattggttttagatgcatactttagtggaaccaaaatt
caatggattttggaaaatgtaaaaggtgtaaaagccagagcggaaaaaggaaagatattt
tttggaaccatagatacgtatttactatatcgtttgaccaacggaaaatcgcataagacc
gatcatacgaatgcaagtagaactttgatctacaatatcgaaaagaaagaatgggataag
gaattaactcaaatattaggaattcctgattctattttaccagagacgcataattctagt
tcattgttcggaagaacggaaaaggtaaaaggacttcctgacggaattccaatttcctct
cttgtgggagatcaacaaggggccttatttggccaactttgcacagagcctggggaagcc
aagaacacgtatggaaccggatgttttcttctttttaatactggaaataattttcagatt
tctaagaacaatttacttactaccttaggatgtggaccggaaggaaagactgtttattgt
ttggaaggatccgtttttataggaggcgctgtcgttcaatttttaagagataatctgaaa
ttttttaaagaatccaaaatttccgaaaagtatgcgtcttcggtaaaaaaagaagacgat
gtagtttttattcccgcctttgcagggttaggtgctccttattgggatatgaacgcgagg
ggtgcaattttaggtctgacaagagatactacagcggaacagatcacaagagctgcgctc
aaatcgattgccctccaatcttatgaacttgtagaggcaatggaaaacgatactggttct
aaattaaaagttttaaaagtagacgggggtgcgactggaaattcttggttgatgcagtat
caatctgatatattaggaaaacgtgtagttcgtccttccaatgtagataccacggtatta
ggtgcggcatttttggcgggattagaaaggggattttttccttccgtagtggatctaaaa
aagaaactaaaaacgagtaaggaattttctccacagatgaaacaaccccaaagagaaaaa
gagattcagatttggaaggattctgtccataggatccgaaccaatcaataa

DBGET integrated database retrieval system