KEGG   Leptospira interrogans serovar Lai 56601: LA_2361Help
Entry
LA_2361           CDS       T00098                                 

Gene name
tdh
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:lil01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lil00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:lil00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:lil00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:lil00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:lil00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2338353..2338898)
Genome map
AA seq 181 aa AA seqDB search
MRSRRIDYGWYGSIGLFAAAYAKAGGAGSVDYVDTNKMRLGIAEKIGVNPIESPPKQRIG
RRPGKYPITVDTSGSSEGLLCAIRSTEPEGYCSSIGGHFGDIAFPMLEMYAKGIHFYTGR
GLGRINFEAATDFIISGKVKPELIVTEERPFDEAAEVLRDPSMKPVLVRQTMLSKAYQPK
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgcggagcagacgtattgattatgggtggtacggttctatcggactatttgcggctgct
tatgcaaaggctggtggggctgggtccgtcgactatgttgacacaaacaaaatgcggtta
ggtatcgctgaaaaaataggagtaaatccgatcgaaagtcctccaaaacaacggattggc
aggcgccctggaaaatacccaatcactgtggatacaagcggttcatccgaaggtctttta
tgtgcaattcgttctacggaacccgaaggttattgttctagtataggtggtcactttgga
gacattgcgtttccgatgttagagatgtatgccaaagggatacacttttatacgggacgt
ggtttaggaagaatcaactttgaagcggctacggattttattataagtgggaaagtcaaa
ccggaactgatcgttacagaagaaagaccgtttgatgaagcggctgaagttttacgggat
ccttctatgaaaccggtattagttcgacagaccatgctttctaaggcttaccagcccaag
gtataa

DBGET integrated database retrieval system