KEGG   Leptospira interrogans serovar Lai 56601: LA_2361Help
Entry
LA_2361           CDS       T00098                                 

Gene name
tdh
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LA_2361 (tdh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA_2361 (tdh)
  Lipid metabolism
   00071 Fatty acid degradation
    LA_2361 (tdh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LA_2361 (tdh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LA_2361 (tdh)
   00626 Naphthalene degradation
    LA_2361 (tdh)
Enzymes [BR:lil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LA_2361 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2338353..2338898)
Genome map
AA seq 181 aa AA seqDB search
MRSRRIDYGWYGSIGLFAAAYAKAGGAGSVDYVDTNKMRLGIAEKIGVNPIESPPKQRIG
RRPGKYPITVDTSGSSEGLLCAIRSTEPEGYCSSIGGHFGDIAFPMLEMYAKGIHFYTGR
GLGRINFEAATDFIISGKVKPELIVTEERPFDEAAEVLRDPSMKPVLVRQTMLSKAYQPK
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgcggagcagacgtattgattatgggtggtacggttctatcggactatttgcggctgct
tatgcaaaggctggtggggctgggtccgtcgactatgttgacacaaacaaaatgcggtta
ggtatcgctgaaaaaataggagtaaatccgatcgaaagtcctccaaaacaacggattggc
aggcgccctggaaaatacccaatcactgtggatacaagcggttcatccgaaggtctttta
tgtgcaattcgttctacggaacccgaaggttattgttctagtataggtggtcactttgga
gacattgcgtttccgatgttagagatgtatgccaaagggatacacttttatacgggacgt
ggtttaggaagaatcaactttgaagcggctacggattttattataagtgggaaagtcaaa
ccggaactgatcgttacagaagaaagaccgtttgatgaagcggctgaagttttacgggat
ccttctatgaaaccggtattagttcgacagaccatgctttctaaggcttaccagcccaag
gtataa

DBGET integrated database retrieval system