KEGG   Leptospira interrogans serovar Lai 56601: LA_2561Help
Entry
LA_2561           CDS       T00098                                 

Gene name
bglX
Definition
glycosylhydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LA_2561 (bglX)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LA_2561 (bglX)
Enzymes [BR:lil01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LA_2561 (bglX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2545822..2547681
Genome map
AA seq 619 aa AA seqDB search
MEVKKKQLKIKIIILKQNITPLLPEFVFTEFPVFLFCQTMIRRFLFVSLLLLGFLTILYY
VSSYQQDLQANSLDGYLEFQAKEIVNKMSPEELSGQVIHVSIPGKTLDQTAEKEIEEILP
GGIILFGINLGTKEEISNLNLELQKKSIEFSKLPLLISVDQEGGRVLRVRDGVTQFPGAM
ALGQTKNSDYAYKVGFVTSYQLRKLGLNFVFAPDLDINNNPDNPVINTRSMGSTPEMVSI
AGIGYEKGARIGGAIPTIKHFPGHGDTNVDSHLGLPKIDKTLEELEKMELIPFQESIQQG
AEVVMSAHIVYPKLDPDFPATLSSKILKGILRERMGFKGVVITDAMEMDAIDKHYKDKNP
GVLAILAGADILLMTSWGKTTRDMKNQILTAYKNGIFQKGERDLLKEAVYRQILLKLKHG
IIYEFSSKKSESKEKLSDLEIKEIDFFQNQIAQREKNFLEIFSSNLNAEISRASIVSFPS
LFDPNSVKTEETIFSVRGKEFETALEEKNIPNVNYSKIPVLVKQNKFKRIVAVTFSQLEL
DLVAKLAKRHSNLEVVALHYGSPFLKLNALPNLKILFSFSPTLESKKALLYSVLERKSTI
PVVDLILKGENEKTASQQP
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaaaaagaaacaactgaaaataaaaatcattatcttgaaacaaaacataaca
cctctactcccggaatttgtttttacagaatttccggttttcttattctgtcaaactatg
atccgacgttttcttttcgtgtccttacttcttttgggttttctaaccatactctattac
gtaagctcttatcaacaagatctacaagcaaacagcttggacggttatttagaattccaa
gccaaagaaatcgtaaacaagatgagcccggaagaattgtcgggacaagtaattcatgtg
tcgattcctggcaaaaccttagatcaaaccgcagagaaagaaatcgaagagattctacct
gggggaattattctttttggaatcaatttaggcacaaaagaagaaatctcaaatctgaat
ttagaattacaaaaaaagagtatagaattttctaaattgcctcttttgatttcagtagat
caagaaggaggaagagttttacgtgtgagagacggagtcactcagtttccaggtgcgatg
gctcttggccaaaccaaaaactctgactacgcgtataaagtaggttttgtaacttcttat
caacttagaaaacttggactgaattttgtttttgctccagacttagatatcaacaacaat
ccagataatccagtgattaacactcgttctatggggagtactcctgaaatggtttctatc
gcaggaattggatacgaaaaaggagcaagaatcggcggagccattcctacaatcaaacat
ttcccaggtcacggagacacaaacgtagacagtcatttaggacttccaaaaattgataag
accttagaagaattggaaaaaatggaactgattccatttcaggaatcgatccaacaaggt
gcagaagttgttatgagcgctcatatcgtatatcctaagttagatcctgattttcctgct
acactttcctctaaaattctcaaaggtattttaagggaaagaatgggattcaaaggtgtg
gtcatcacagacgcaatggaaatggatgcaattgataaacattataaagataagaatccc
ggggtcctcgctatattagcaggagctgatatactactcatgactagttggggaaaaacc
accagagatatgaaaaatcaaattttgactgcatacaaaaatggaatttttcaaaaagga
gaaagagatcttttaaaagaagcggtatacagacaaattttattaaaactcaaacacgga
attatatatgaattttcttctaaaaaatcagaatcaaaggaaaaactatccgatttagaa
atcaaagaaatcgacttctttcaaaatcaaattgcacaaagagaaaaaaattttttagaa
atattttcctctaatttaaacgcagaaatttccagagcttcgatcgtttcttttccttct
ctatttgatccgaattctgtcaaaacagaagagacgatattttcagtgcgcggaaaagaa
tttgaaactgctttagaagaaaagaatattccaaatgtaaattactcaaaaattcctgta
cttgtaaaacaaaataagttcaaacgaattgtagcggttacgttcagccagctggaatta
gatctcgtagcaaaacttgcaaaacgtcattccaacttggaagtagttgcacttcattac
ggaagtccgtttctaaaattgaatgctcttcccaaccttaaaattttattttctttttcc
cctacgttagaatctaaaaaagctcttttgtattctgtattagaaagaaagtctacaatt
ccggttgtagatctgattttaaaaggtgaaaacgaaaaaaccgcgtcccaacagccatga

DBGET integrated database retrieval system