KEGG   Leptospira interrogans serovar Lai 56601: LA_2629Help
Entry
LA_2629           CDS       T00098                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LA_2629
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA_2629
  Lipid metabolism
   00071 Fatty acid degradation
    LA_2629
  Amino acid metabolism
   00350 Tyrosine metabolism
    LA_2629
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LA_2629
   00626 Naphthalene degradation
    LA_2629
Enzymes [BR:lil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LA_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2614956..2615984
Genome map
AA seq 342 aa AA seqDB search
MKRIVFKKKHVLEWENVPEPKIQGINQAIVKPIAVSRCDLDLPIVNGYTLFRPGIPIGHE
FVGMIEETSPEIANQYPKGTKVIIPFQISCGICPDCTLGRSKACTSVPYASHYGMGPSAK
EFGGALSEKIWIPFAKQMLIPMPSDMDVISLASISDNIVEAWKLVGQWLEKKPNSPVMIL
GGLASSIGLYSASLAVGMGSSEVLYLDNDSERLKIAESLGAKAVSYSVLPKAWERKFPLI
ADCHGLKEGMDFALKSLSTEGIYGSASIFWTNKLEIPYLDLYNTGTTLKIGRVDSREYIP
HILKKISEKKIKPEKIVTKICSFEEATEAWLEPAIKLVVKMD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatcgtattcaaaaaaaagcatgtattggaatgggaaaacgttcccgaacca
aaaattcaaggaatcaaccaagcaattgtaaaaccaatcgcggtttcgcgttgtgatctg
gatcttccgatagtaaacggttatactttatttagaccgggaattccaatcggtcatgag
ttcgtaggaatgatcgaagaaacgagtcctgaaatcgcaaaccaatatccgaaaggaacc
aaggtaatcattccgtttcaaatttcctgtggaatttgtccagattgtacactaggacgt
tccaaggcttgtacttcggtcccttacgcaagtcattacggaatgggaccttccgcaaaa
gaattcggcggtgccttgtcagaaaaaatttggattccattcgccaaacagatgttaatc
cccatgccttcggatatggacgtgatctcactcgcttcgatcagcgacaatatagtggaa
gcgtggaaattggtaggacaatggctggagaaaaaaccgaattctcctgtaatgattttg
ggaggtttagcttcaagtatcggtttgtattccgcttctctcgcagtaggaatgggttct
tccgaagttttgtatctggacaacgattcagaaagacttaaaattgcggaaagtctaggt
gccaaagcagtttcgtattccgttcttcccaaggcttgggaaagaaaatttcccttgatc
gcggattgtcacggtttgaaggaaggaatggatttcgcattaaaatctctttctacggaa
gggatctatggttctgcatccattttctggacaaataaattagaaattccttatttagat
ttatataatactggaacaaccttgaagattggaagagtagactcaagggaatatattccg
catatcctaaaaaagatttctgaaaaaaagattaaaccagaaaaaattgtgaccaaaatc
tgttctttcgaagaagctacagaagcctggctcgaaccggcgatcaagttggtggttaaa
atggactga

DBGET integrated database retrieval system