KEGG   Leptospira interrogans serovar Lai 56601: LA_2918Help
Entry
LA_2918           CDS       T00098                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LA_2918
  Lipid metabolism
   00561 Glycerolipid metabolism
    LA_2918
   00600 Sphingolipid metabolism
    LA_2918
Enzymes [BR:lil01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LA_2918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2889094..2891034
Genome map
AA seq 646 aa AA seqDB search
MRAILNYKVYENSFTSTFEISGKETKTYSDCRNFSLSLGHKKTGKNETFKPHLEWIGEQR
PKAGTELLTLEIELPPHQLNEPKIFQHGYQSWSLSGVYPLSEIDESPKLDFLRYCQENFY
TNHAGINGDWHSEGMVLLISSSKEPNYFAGAIGPGEQGVKFRVISPSRKEELENSKKKPW
ISNSGISLIYDFYRYEDFRGNKISLTPIGISRFTIEPESYLKKYFSELGKAHKVKLSTTP
VPTGWCSWYQYYTKISEKIILKNLSLIKEKKLPIQFFQIDDGYQKEIGDWLTTNDKFPGG
MRLLAEEIRREKLTPGIWLAPFLVRKKSEFFQKYPEAVLKDRDGKPTPALWNPLWGMDHT
YCIDVTHPTSRDFLENIFKTIVKEFGYSYLKLDFLYAALLSGWTYDRGVSPHKRYTDVIK
FIRKIVGKEVFLLGCGAPIYPSIGLFDAMRISCDVAPFWGREKVRILSKDKHALCTERAL
INDINRSSMHRNLWINDPDCLLVRESKNKMTTAQTQLMASIIAISGGMIFISDDLSLIGE
ERLTFLKRILELGAKCKNKTPIPVGISSGLFPPALYNPAGFLGIWNPSEVESTIEIKTTF
VSKLKQFTDYWTGQVPESLEYSVKTGILKLKLPAFGSVVLQTAKVV
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgagagccattctaaactacaaagtctatgagaattcctttacatccacgtttgaaata
tctggtaaagaaaccaaaacctacagcgattgtcgcaatttttcactttctcttgggcat
aaaaaaacaggaaagaatgaaacgtttaaacctcatctagaatggatcggagaacaaaga
cccaaggctggaacagaattacttaccttggaaatcgaacttcctccacaccaactgaac
gaacctaaaatatttcaacacggttatcaatcctggagtctttccggagtttatccactt
tcagaaatagacgaatctccaaagctagattttctaagatattgtcaggagaatttttac
accaatcacgccggtataaatggggactggcacagcgaaggaatggtccttctgatttct
tcttcaaaagaaccaaattactttgcaggcgcaatcggtccaggtgaacaaggagtaaaa
tttagagtcatttctccttccagaaaagaggaattggaaaattctaaaaagaaaccttgg
atttccaactctggaatttctttaatctatgatttttatcgttatgaagatttcagagga
aataaaatctctctgactccaataggaatttcccgttttacgatcgaaccagaatcatac
ttaaaaaagtattttagtgaattaggaaaagctcataaagtaaaactttctaccactcca
gttcccacggggtggtgttcctggtatcaatactatactaaaatatccgaaaagattatt
ctgaaaaatctttctcttataaaggagaaaaaacttccgatccaattctttcagatagac
gacggttatcaaaaagaaattggagactggctcactacaaatgataaatttccaggtgga
atgagactattagccgaagaaatccgaagagaaaaactaactcctggaatttggctcgct
ccttttttagttcgaaaaaaatccgaatttttccaaaaatatccagaagcggttttaaaa
gatagggacggaaaacctacccctgcgctttggaatcctctttggggaatggaccacacg
tattgtatagacgtcactcaccctacttctagagattttttagagaatatttttaaaaca
atcgtaaaagaatttggttattcctatctcaagctggactttctatatgcagccttactt
tcgggctggacttacgaccgaggagtttcacctcacaaacgttatacggatgtaattaaa
tttatccgtaaaatagtaggaaaagaagtatttttactaggatgtggggctcctatctat
ccttcgatcggactttttgacgcgatgcggattagttgcgacgtggctcctttttgggga
agggaaaaagttaggattttatccaaagacaaacacgctctttgtacggaaagggctttg
atcaatgacatcaatcgttcttcgatgcatagaaatttatggattaacgatccggattgt
cttttagttcgggaaagtaaaaataaaatgaccaccgcacaaactcaattgatggcaagt
atcatagcaataagcggaggaatgatttttatcagtgacgacctttctttgatcggagaa
gaaaggcttacctttttaaaaagaattttagaactaggagccaaatgtaaaaacaaaact
ccaattccagtaggaatttcttccggactttttccaccagcactttacaaccccgccggt
tttttaggaatctggaacccaagcgaagtagaaagtacaattgaaatcaaaactactttc
gtttccaaactcaaacaatttacagattactggaccggacaagttccggaatctctagaa
tactctgtaaaaacaggaatcctaaaactaaaacttcccgcattcggttccgtggtatta
caaaccgcaaaagttgtttga

DBGET integrated database retrieval system