KEGG   Leptospira interrogans serovar Lai 56601: LA_2974Help
Entry
LA_2974           CDS       T00098                                 

Gene name
mauG
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lil  Leptospira interrogans serovar Lai 56601
Brite
Enzymes [BR:lil01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     LA_2974 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2951042..2952241
Genome map
AA seq 399 aa AA seqDB search
MRFLVYSISLLFLIRCGSGILPFSPFNKKESNLNELLLLFLIPQNSYVWNLPPGFPTPVV
PASNPMTQEKVDLGRFLFYDRKLSGNQTQSCASCHKQSLAFTDGLTKGIGSTGEVHPRNA
QGIINVAYNVRQTWVNPTLKDLEDQMLVPMFGEHPVELGLTNHENELLDRLRSENRYQSM
FQKAFPLGDPFTVSNVIKAIACFERTLISGRSPYDKYLYDGNISALGNSAQRASILRGAQ
IFFSEKGECFHCHGGFNFTETSIHSGSVNAEITFHNNGLYNIGGTGDYPVDNPGLFEFTG
LASDKGKFRAPSIRNIELTAPYMHDGSIDSLENVVEHYNAGGRNILNGLYAGDGRANPNK
NAFVFPIGLTAGEKTDLVNFLKSLTDTEFVNDPKHSNPF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagatttttagtatattctatttctttgttatttttaattcgttgcggatctggaatt
cttcccttctctccctttaacaaaaaagaatccaatttaaacgaacttttactacttttt
ttgattccacaaaactcttacgtttggaacttacctcctggttttcccactccggttgtt
cccgcttccaatcctatgactcaagagaaagtagatttaggcagatttttattttatgat
cgcaaactttcgggcaaccagactcagtcttgtgcctcttgtcataaacaatccctcgct
tttacggatggtctgaccaaaggaattggttctacgggagaagtacatcccagaaacgct
caaggaattatcaacgttgcatataacgtgcgtcagacttgggtcaatccgactctaaaa
gatttagaagatcaaatgctcgttcccatgttcggagaacacccagtagaacttggtcta
accaaccacgaaaacgaattactcgatcgtttgagatcagaaaatcgttatcaatctatg
tttcaaaaggcgtttccactcggagatccttttacggtttccaatgtaatcaaggcaatc
gcctgttttgaaagaaccctcatctccggacgttctccctacgataaatatttgtatgac
ggaaatatttccgcgcttggcaattccgcccaaagagcttctattctcagaggagcccaa
attttcttttcagaaaaaggagaatgttttcattgccacggaggttttaactttacggaa
acgagtattcactccggaagcgtcaatgcagaaattacatttcataataacggtttatac
aatataggtgggactggggattatccagtagacaatcctggattgtttgaatttacagga
ttagcttctgataaaggtaaattcagagctccttctattagaaatattgaattaactgct
ccttatatgcacgacggttcgatcgattctttggagaacgtcgtagaacattacaacgcg
ggaggcagaaacatactcaacggtctttatgcaggagacggaagagccaatccaaataaa
aacgcatttgtttttccaattggtctgaccgcaggcgaaaaaacggacctagttaatttt
ctaaaaagtttaacggatacggagttcgtaaatgatccgaaacacagtaatcctttctaa

DBGET integrated database retrieval system