KEGG   Leptospira interrogans serovar Lai 56601: LA_3288Help
Entry
LA_3288           CDS       T00098                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LA_3288 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LA_3288 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LA_3288 (trpA)
Enzymes [BR:lil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LA_3288 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3263038..3263832)
Genome map
AA seq 264 aa AA seqDB search
MNSISSVFSSEQSVFIPYISLGDPDYDSCVIWADALIRGGAGILELGIPFTDPVADGPVI
QKAFKRSLAHPFSMDKILEVTSEIHKLHPQIPLVYLTYFNPLFSMGLESFTERAKNSGIQ
GLIIPDLPFDTPEAEEFFSQLERKRIDFIHLVTPATTEDRIRSMKSLASGFIYYVTSYGV
TGERGSIASGLEDRIRMVRKIVGLPVCAGFGISTSDQSKVISTYADGVIIGSAVQRIIEE
NGSDRNNCADKLLAYASEIRASMR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgaactccatttcttccgttttttcttcggagcaaagtgtttttattccttatatttct
ttgggtgatccggactatgattcctgcgttatttgggcggatgctttgattcgaggtggt
gccggcattttagaattgggaattccttttactgatccggttgccgatggtccagtgatt
caaaaagcttttaaacgttctttggctcatcctttttccatggataaaattttagaagtt
acttcggaaattcataaacttcatcctcagattcctctcgtatatcttacttattttaat
cctttgttctctatgggtttggaatcttttacggaaagagctaaaaattctggtatccaa
ggtttgatcattccggaccttccgtttgataccccggaggcggaagaatttttttctcaa
ctcgaaagaaagagaatcgattttatccatcttgtgactcctgctactacggaagacaga
attcgttcgatgaaatctcttgcgtccggttttatctactatgtgacttcctacggcgtt
accggggaaagaggttcgattgcgtctggtttggaagatagaattcgaatggtgcgtaag
attgtcggtcttccagtttgtgctggttttgggatttccacttcagatcaatctaaggtt
atttcgacttatgcagatggagtgatcatcggttctgccgtgcaaagaatcattgaagaa
aacggatctgatcgtaataactgtgcggataaacttctggcctacgcttctgagattcgt
gcttcgatgagatag

DBGET integrated database retrieval system