KEGG   Leptospira interrogans serovar Lai 56601: LA_3292Help
Entry
LA_3292           CDS       T00098                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00900  Terpenoid backbone biosynthesis
lil01100  Metabolic pathways
lil01110  Biosynthesis of secondary metabolites
lil01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA_3292 (dxr)
Enzymes [BR:lil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     LA_3292 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 1152634
NCBI-ProteinID: NP_713472
UniProt: Q8F146
Position
I:complement(3268482..3269651)
Genome map
AA seq 389 aa AA seqDB search
MTTSVCLLGASGSVGESTLKVLRAHPEKFRLHSFSVHSNLEKAKEIQKEFSPDFICVSSD
FADVGVLGNKLGRTQILYGESSLCELVREPEVEIVITAIVGSVGLRPTIAAITAGKRLGI
ANKETLVTSGPLIQSLIAKHNTKVVPVDSEHNALFQLLESLNPNSVEKIILTASGGAFRD
LPVEQLSSVTKEQALHHPTWNMGPKITIDSNGMINKGLEVIEAHFLFNVPYDKIGVVIHP
QSIAHGIVELKDGASFLYASYPDMIFPIAHSLFHPEPVPKVLRSYPAKDWGKLEFREPDF
KRYPGLGLAFEAGKVGGTAPCIFNAANEAAVELFLKDEIRFIEIPDYIRETLDEIKIEFP
LSLEEYEEADRIARETVRNLKARKVVSAC
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctccgtctgtcttttaggcgcttccggttccgttggagaatctactctaaag
gtgcttcgcgctcatccggaaaaatttagacttcattctttcagcgttcattctaatctt
gaaaaagcaaaagagatccaaaaagaattttctcccgattttatctgtgtgagttccgat
tttgcggatgtcggagttcttggaaataaattgggtagaacacaaattctttacggtgaa
tcctcgctttgcgaactagtacgcgaacccgaggtggagatcgtaatcactgctattgtg
ggttctgttggtttacgtcctacgattgcggcgatcacagcgggaaaaagattaggaatt
gctaataaagaaacgttagtcacatcaggtcctctgattcaatctctgatcgcaaaacac
aatacaaaagtagttccggtggattcagaacacaatgcactctttcaacttttagaatct
ttaaaccctaactctgtggaaaaaattattcttaccgcgtcgggaggtgcttttcgggat
ttacccgtagaacaactctcctccgttacaaaagaacaagcattacatcatcctacttgg
aacatggggcctaagattacgatcgattctaatggtatgattaataaaggacttgaagtg
atcgaagctcattttttgttcaatgttccgtatgataaaattggggttgtgattcatcct
cagagtatcgctcacggaatcgtagaattaaaggacggggcttcttttttatacgcttct
tatccggatatgattttcccgattgcacattctctctttcatccggaaccggttcctaaa
gttttacggtcttatcctgctaaggattggggaaaattagagttccgagaacctgatttc
aaacgttatcctggtttaggtcttgcgtttgaggcgggtaaggtaggaggaacggcacct
tgtatttttaacgcggctaatgaagccgctgtagaattgtttttaaaagatgaaatccgt
tttatagaaattcccgattacattcgggaaacgttagacgaaattaaaattgagttcccg
ttgtctctagaggaatacgaggaagcggatcggattgcccgcgaaaccgtccgaaatctg
aaagcaaggaaggtagtatccgcatgttga

DBGET integrated database retrieval system