KEGG   Leptospira interrogans serovar Lai 56601: LA_3354Help
Entry
LA_3354           CDS       T00098                                 

Gene name
adhP
Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LA_3354 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA_3354 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    LA_3354 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LA_3354 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LA_3354 (adhP)
   00626 Naphthalene degradation
    LA_3354 (adhP)
Enzymes [BR:lil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LA_3354 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3323558..3324589)
Genome map
AA seq 343 aa AA seqDB search
MKAAVLESGKKILEIRDVSVPQLRAEQVKVRIKACGICGSDVHLVVHGTLKCKHFPRVPG
HESSGIIEEVGENVRRFRKGDRVVIAAGTSCGVCSYCKEGKENLCKDLGVFGFDRDGSFA
EFNIVEERYLYSLPDEIPFDQGAILADAVSTPYHAIRYRGNIQESDTVAIFGCGGLGIHA
VAIARAMTKGKVIALDVDSGALENATKYGADEVVNLKEVRNSGKVLKEVSKGVDLLADFS
GYMSNVEDSIRAMNPGGRIVLVGIGRQPLKFQIPFILIEKMISVSGSYGSDRRAIPELIE
LYLKGKINLSHSITSHHPLEELNECLEALDQRKGNPIRFIVEP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcggttttagaatccggtaaaaaaattttagagatcagagatgtttccgtt
ccacaacttagggctgaacaagtaaaggtaagaattaaggcttgtggtatttgtggttca
gacgtacatctcgtggttcatggaactctcaaatgtaaacattttcccagagttccagga
catgagtcatcgggaattatcgaagaagtaggcgagaacgttagacgattccgtaaagga
gatcgagtggtcatcgcggccggaacttcatgtggagtttgttcttattgtaaagaagga
aaagaaaatctatgtaaagatttaggggtgtttggttttgatcgagatggaagttttgca
gaatttaatatagtagaagaacgttatttgtattctcttccagatgagattccatttgat
caaggagcgattcttgcagatgctgtatctactccttatcacgctattcgttacagaggg
aatattcaggaaagtgatacagtagctatttttggttgtggggggcttggaatccatgcg
gtggcgattgcaagggcgatgacaaaaggtaaggtgattgcattggatgtggattcggga
gctttagaaaacgctaccaaatatggagctgatgaagtggttaacttgaaagaagttcga
aattcgggcaaggttctaaaggaagtatcgaaaggtgtagatctacttgccgacttttcg
ggttatatgtctaacgtagaagattcaatacgagcgatgaacccgggaggtagaattgta
cttgtaggtattggaagacagcccttgaaatttcagattccttttatattaattgaaaaa
atgatttctgtttctggttcttatggatccgatcgtagagcgattcctgaattgattgaa
ctttatctaaaaggaaaaatcaatctttctcattcgattacttctcatcatccattagaa
gaattgaatgaatgccttgaggccttggatcagagaaaaggaaatccgattcggtttatt
gttgaaccttaa

DBGET integrated database retrieval system