KEGG   Leptospira interrogans serovar Lai 56601: LA_3998Help
Entry
LA_3998           CDS       T00098                                 

Definition
(RefSeq) cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    LA_3998
Enzymes [BR:lil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     LA_3998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C Abhydrolase_1 FAD_binding_3 NAD_binding_8 Pyr_redox_2 FAD_binding_2 Pyr_redox DAO Fer4_9 Fer4_6 Fer4_7 Fer4_10 Fer4_2 GIDA HI0933_like FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 1153340
NCBI-ProteinID: NP_714178
UniProt: Q8EZ60
Position
I:3978784..3982191
Genome map
AA seq 1135 aa AA seqDB search
MIQKISQPIEKIKNQYEAVVIGSGYGGAIAASRLSRAGIEVCLLERGKEIRPGEFPNKEI
SALEEVQANYEDKQIGPKNGLFDFHFNKDINVLVGCGLGGTSLINANVSLRAVPEVFQDP
AWPKNIREEASKHGFDPYYSLAEEMLRPNPIPNQYRNLAKHQALKTSASFLKKEFYPTPI
NVTFQSKINHVGVKQEACTNCGDCVTGCNVSSKNTTLMNYLPDAANFGAQIFTEVKVSYI
EKQEDSWLIHFVPLGLDREKFSKDELFIRAKTVILSAGSLGSTEILLRSKEKGLNVSDSV
GVRFSGNGDMLGFSYNGNTTINGIGFGSKKTNTEVGPCITGVIDTRKGASLNEGMIIEEG
SIPGAIRGQLPEIFAIASKLTGVKTKKGFFQWVIEKIRIFLSFILGSYRGAVKNTQTYLV
MAHDGNDGKMFLQNDRLRISWPNVGKKPIFEKISTILKEATVPLQGTYIKNPVWNRLTDQ
DLISVHPLGGCPMGDDASTSAVNENCQVYSGKSGKETYNGLYIMDGSVIPRSLGVNPLLT
ICAISERACEKLISQKGLTINYNLPSYPKHTNVPDEKTLGIEFTECMKGFFSTQSKEDTE
RGYQIGKDEGSSIEFLLTIRSENLNEMISNPDHKATLFGTVKAPVLSKDVITVTNGEFLL
FISREDKVETRNMVYRMILNTEEGKKYLFVGAKWIQNDGLTNIWRDTSTLFTTIYEGETE
NSPVLGKGILHILPEDFAKQMTTMKVIHAKSLIDTIQGLTKFGSFFAGALYDVYGGVASS
IVPWDKDARPRTKRPLRVSSPEVHFFKAEDGANLRLLRYKGGNKGPVLLSPGLGVSSLIF
SIDTIDTNLLEYLFENQYDVWLFDYRTSIALPSAPLPNTGDAIATKDYPAAVNKVRELTK
VDKIQVVAHCFGATTFTMALLSGLEGVRSVVLSQISADVEVPTSMDIKVGFHTAEILDAL
GIKDMTAYTSNHDDWLDRFFNSVLALQPQSLFSHDVNPVSRRISFLYGSLYILENLNEET
YRYGLGEMFGVSNIKAFEHLSKMIRAHKVVNSEGQDVYVPHLDRLNLPITFIHGAQNRCY
LPESTETTYKKLIDRFNPNQYRRHVIPDYGHIDCIFGKDAYKDVYPFILQSLNRY
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
ttgattcagaaaatatctcaacccatcgaaaaaattaaaaatcaatacgaagcggtcgta
atcggatccggttatggcggggcaatcgcggcatctaggctttccagagccggaatcgag
gtctgtcttttagaaagaggcaaagaaatcaggccgggagaatttccgaataaagaaatc
tctgctttagaagaagtacaagcaaactacgaagataaacaaatcggccctaaaaatggt
ctgtttgattttcactttaacaaggatattaacgttttagtaggttgtggcttgggaggc
acttcgcttatcaatgctaacgtaagccttagagcagttccggaagtgtttcaagatccg
gcttggcctaaaaatattcgagaagaagcaagtaaacatggatttgatccgtattattct
cttgctgaagagatgttaagaccaaaccccatcccgaatcaatatcgaaatctcgccaaa
caccaagcactgaaaacatccgcttcttttttaaagaaagaattttatcctactccgatt
aatgtaacgttccaatccaaaatcaatcacgttggagtcaaacaagaagcttgtacaaat
tgtggagattgtgtaaccggttgtaacgtatcttctaaaaatacaactctgatgaattac
ctcccagatgcagcaaatttcggcgctcaaatttttacggaagtaaaagtaagttatatt
gaaaaacaagaagattcttggctgattcattttgttccacttggactcgatcgggaaaag
tttagtaaagacgaattatttatccgcgctaaaacagtaattctttccgcaggctcttta
ggttctactgaaatcctacttcgctccaaagaaaaaggactcaacgtttccgactctgta
ggagttcgttttagcggaaacggagatatgttaggtttttcttataatggaaatactacg
atcaacggaatcggctttggttctaaaaaaacaaacacagaagtaggcccttgtatcact
ggagtcatcgatacacgtaaaggtgcatctttaaatgaaggaatgattatagaagaaggt
tctatcccaggtgcgattcgaggtcaattaccagaaatttttgcgattgcgtctaaactg
acaggagtaaaaaccaaaaaaggtttttttcaatgggtaattgagaaaattagaatattc
ttaagttttattttaggttcttatagaggcgcagttaaaaacactcagacttatttagta
atggcgcacgatgggaatgacggaaaaatgtttcttcaaaatgatcgtttgagaatttcc
tggccgaacgttggtaaaaaaccgatttttgaaaaaatcagtacgatactaaaagaagct
actgttccactgcaaggaacctatattaaaaaccctgtatggaatcgtctaacggaccag
gatttaatttccgtccatcctctcggcggttgtccaatgggagacgacgcttccacttcc
gcagtcaatgaaaattgccaggtttattccggcaaaagcggcaaagaaacgtataacgga
ttgtacatcatggacggttctgtaattcctagatccttaggagtcaatccattacttaca
atctgtgctatctcagaaagagcctgcgaaaaactaatctctcaaaaaggtcttacaatc
aattacaatcttccttcatatcctaaacatacaaacgtcccagatgaaaaaacattaggc
atagaatttacagaatgtatgaaaggttttttttccactcaatccaaagaagacacagaa
agaggttatcaaatcggtaaggacgaaggctcttccatagaatttttacttacgatccga
agcgaaaacctaaatgaaatgattagtaatccggatcacaaggcaacgttattcggcact
gtaaaagctcctgttctttccaaagacgtaatcactgtaacaaacggagaatttttactt
tttatttctagagaagacaaagtagaaacgagaaacatggtttatcgtatgattctcaat
acggaagaaggcaaaaaatatctttttgtaggagccaagtggatacaaaacgacggactt
acaaacatctggagagatacaagcacgctttttactacgatttacgaaggtgaaacagaa
aattctcctgttttaggaaaaggaattttacacattcttccagaagattttgccaaacaa
atgaccacgatgaaagtcattcatgcaaaatctctaatagacacaatccaaggattaacc
aagttcggttctttttttgcaggtgcactgtatgacgtttatggtggagtagcaagttcc
attgttccttgggataaggacgcaagacctagaaccaaaagacctttgagggtttcttct
cccgaagttcattttttcaaagcagaagacggagccaacttaagacttttaagatataag
ggtggtaacaaaggaccagttctgttatctcctgggttaggcgtctctagtttgattttt
agcatcgatacgatcgatacaaatcttttagaatatctttttgaaaatcaatacgacgtt
tggctttttgattatagaacttcgattgctcttccttcagcccctcttccaaacacagga
gacgcgatcgctaccaaagattatccggctgcagttaacaaagtaagagaactcaccaaa
gtagataaaattcaagtagtagctcattgttttggcgcaactacatttacgatggcgtta
ctctctggtttagaaggagttcgctccgtagtgctgtctcaaatttctgcggatgtagaa
gttcccacctcgatggatattaaagtaggatttcatactgcggaaattttagacgccctt
ggaatcaaagatatgaccgcgtatacgagcaatcacgacgattggttggatcgattcttt
aacagcgttttagcgttacaacctcagtcccttttttctcacgacgtaaacccggtcagc
agaagaatctcctttctttacggtagtctctatatattagaaaatttgaatgaagaaacc
tatcgttacggtttgggagaaatgttcggagtttcaaacatcaaagcgtttgaacattta
tctaagatgatccgcgctcataaggtagtaaattcagaaggacaagacgtttacgttccc
catttggatcggctcaatctaccaatcacgttcattcacggagcgcaaaatcgttgttat
ctcccagaaagtacagaaacaacctacaaaaaactaatcgatcgatttaacccaaatcag
tacagacgtcacgtaatacctgactacgggcacatagattgtatatttggaaaagacgcc
tacaaggacgtatatccatttatactacagtctttaaatcgatattaa

DBGET integrated database retrieval system