KEGG   Leptospira interrogans serovar Lai 56601: LA_4215Help
Entry
LA_4215           CDS       T00098                                 

Definition
(RefSeq) strictosidine synthase
  KO
K01757  
strictosidine synthase [EC:4.3.3.2]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
Enzymes [BR:lil01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     LA_4215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
I:4192751..4193827
Genome map
AA seq 358 aa AA seqDB search
MFKRIVIFLFILIFLSLSFLIFLFLRSSKNTNESITDSPFDPGKNNYLLESEWIHKENLN
QPYAIAIDARGYVYTGTADHKVVQIRTNEKIETFAVLSGRPLGMVFDSHGNLLVCVEEVG
IVKIRKDGSQKTIISKLPDGSPLRFPHGIDISKDGKIYFTVSSQSYSLQESFLEELFSRP
NGMIVTADKNLTLEILNQDLYYPTGIALSSNEEFLLVSEPFRHRISSIPIFGSQRGTEKF
FLTNIPGIPALISGNGGFFWVGIPYHRNEILDKTQEYPEIKNLLTGLPVFLFGKNIPRGL
VFALNDFGDITANYQGFSDSSVAGITAVLNHAGNIYLVSSTIGKIAKMKPIIEEIQFF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagaattgtaatattcctttttattcttatttttctttctttatccttcttg
atttttttatttttacgttcaagtaagaatacaaatgaatccatcacggattctcctttt
gatcctggaaaaaataattatcttttagaatcggaatggattcataaggaaaatttaaac
caaccttacgcaatcgctatagacgctcgcggttatgtctatactggaaccgcagatcat
aaagtcgtacaaatccgtactaacgaaaaaatagaaaccttcgccgttctttcaggaagg
cctttaggaatggtatttgattctcacggaaatcttttggtttgtgtagaagaagttgga
atcgtaaaaattcgtaaagacggatcacaaaaaactattatctctaaacttccggacggt
tcacctcttcgatttccacatggaattgacatttctaaagacggaaaaatatatttcacc
gtttccagccaatcgtattcattacaagaatcttttttagaagaacttttttctcgccca
aacggaatgatagtaacagcggataaaaatcttacattagaaattttgaatcaagatttg
tattatcctactggaatcgcattgtcttctaacgaagaatttttactcgtatcggaacca
tttcgacatagaatttcctcgattccgatattcggttctcaaagaggtacggagaaattt
tttcttacgaatattcccggaattcccgctttgatcagtgggaacggaggttttttctgg
gtcggaattccatatcatagaaatgaaattttagataaaacccaagaatatcccgaaatt
aaaaacctactgacaggtttacctgtttttctttttggaaaaaatattccgagaggtttg
gtatttgctttaaatgattttggagatattacggccaattaccaaggtttttcggattct
tcggttgcaggtattaccgcagttttaaaccacgccggaaatatttatttggtatcttcg
accatcggaaaaatcgcaaagatgaaaccgataatcgaagaaattcaatttttctaa

DBGET integrated database retrieval system