KEGG   Leptospira interrogans serovar Lai 56601: LA_4333Help
Entry
LA_4333           CDS       T00098                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lil00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LA_4333 (recR)
DNA repair and recombination proteins [BR:lil03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LA_4333 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:4312962..4313567
Genome map
AA seq 201 aa AA seqDB search
MAENLANHLLDEMIEALSSLPGIGRKSAFRISFHLLRLEQGLFNQFIHQLTDTKNKIKFC
KRCGSYAETEICEICVSEKRDSHTFCVVEQPEDIFFIENTREFQGKYHVLNGVISPLEGI
GPRDLRIKELLERIEPEQVKEVLIATNPTLEGDATADYLANQLKPISVNVTRIAYGITVG
GSIELADQYTLGRAIRSRLQL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttggcggaaaatttggctaatcatcttcttgatgaaatgatagaagctctttcttctctt
ccaggaattggaagaaaaagcgcttttagaattagttttcatcttttaagattagaacaa
ggtctttttaaccaattcattcatcaacttacagatacaaaaaataaaatcaaattttgc
aaacgttgcggctcttatgcagaaactgaaatttgcgagatctgtgtttccgaaaaaaga
gattctcatactttttgcgtagtagagcaaccggaagacattttttttattgaaaacaca
agagaatttcagggcaaataccacgtgttaaacggagtcatttctcccttagaagggatc
ggtcccagagatcttagaatcaaagaacttttggaaagaatagaaccagaacaagtaaaa
gaagttttgatcgctactaacccgaccttagaaggagacgcaacagccgattatttagca
aatcaattaaaacctatttcggttaatgtaactagaatcgcttatgggattacggtcggt
ggttcgatcgagcttgctgatcaatatactttaggaagagcaattcgttctcgtcttcaa
ctttag

DBGET integrated database retrieval system