KEGG   Leptospira interrogans serovar Lai 56601: LB_068Help
Entry
LB_068            CDS       T00098                                 

Definition
fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LB_068
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LB_068
Enzymes [BR:lil01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     LB_068
Lipid biosynthesis proteins [BR:lil01004]
 Desaturase
  First
   LB_068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:55772..56593
Genome map
AA seq 273 aa AA seqDB search
MGIILSFFIGHWFLSAFVQSFFLHRYAAHAMFKMNKFWEKFFYIFTCVAQGSSFLNPRAY
AIMHRQHHAYSDTGKDPHSPVASKGFLDMMWKTALNYEAILEETTNVEKEFKGNYPEWPA
IDVLSNSWTFRLFCGTLYTLFYFYFVPEGQYAWYLLLPIHWLMGPLHGAIVNWCGHMYGY
RNHKKNPDNSKNTLFVDFMIAGELYQNNHHAHPNSPNFAFRWFELDFTYQVMKILHFFRI
IKIQRAVWTEKGKKILRGSEVLVEPTSTSTVAA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggggatcattctatcttttttcattgggcactggtttttatctgcttttgttcaatcg
ttttttcttcatagatatgcggcacacgcaatgttcaaaatgaacaaattttgggagaag
tttttttatatttttacttgtgtagcccaaggctcttcttttttaaatccacgtgcttat
gcgattatgcacagacaacaccatgcttatagcgatacaggtaaggacccgcattctccc
gtagcttctaaaggttttttggatatgatgtggaaaactgctctcaattatgaagcgatt
ttagaagaaacaacaaacgtcgaaaaggagtttaaaggaaactatcctgaatggcctgcg
atcgacgttctcagtaattcttggactttcagacttttttgtggaacactttatacttta
ttttatttttactttgtccctgaagggcagtatgcttggtatctacttctgccgatccat
tggcttatggggccgttgcatggagcaatcgtaaactggtgcggtcatatgtatggatat
agaaatcataaaaaaaatccggacaattctaagaatactttatttgtagattttatgatc
gcaggagaattatatcagaataatcatcacgctcatccaaattctccgaacttcgcgttt
cgttggttcgaactggattttacttatcaagtaatgaaaattttgcattttttcagaatt
atcaaaatccaaagagcagtctggaccgaaaaaggaaaaaaaatacttcgcggttcggag
gtacttgtggaacctacgtccacttctacggttgccgcttaa

DBGET integrated database retrieval system