KEGG   Leptospira interrogans serovar Lai 56601: LB_111Help
Entry
LB_111            CDS       T00098                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LB_111
   01230 Biosynthesis of amino acids
    LB_111
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LB_111
   00030 Pentose phosphate pathway
    LB_111
   00051 Fructose and mannose metabolism
    LB_111
   00052 Galactose metabolism
    LB_111
  Energy metabolism
   00680 Methane metabolism
    LB_111
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LB_111
Enzymes [BR:lil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LB_111
Protein phosphatases and associated proteins [BR:lil01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LB_111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:103023..104318
Genome map
AA seq 431 aa AA seqDB search
METKIQNFGECSIPSPADYEYYTSDTSRLIFRTVFQSKEDWNSYVQEGPDFFEQAGPREK
IYFNPQEVTAGIVTCGGLCPGINDVIRGIVMELYYRYGVSRILGFPYGYQGLVKRYSHQP
IELTPEKVAHIVDEGGSMLSSSRGNQSPEEMVDSLSFYGVKILFCIGGDGTLRGARTIVD
EIAKRKEKISVVGIPKTIDNDINYVQKTFGFSTAFSKAMEAVECAHVEAKGAPNGIGLVK
LMGRHSGFIAVNAALASRNVNYCLIPEVDFDLFGNEAFLDDLKKRIQKKGHAVIIVAEGA
GQKFFDSTEERDSSGNLKLKDIGLFLKDTMTEFFKKENIPVNIKYIDPSYIIRSIPANAE
DSVFCGFLAQNAVHAGMAGKTDMVVGMWNNVFTHLPISVAIQERKVLQPDRSTLWRSLLA
STGQPAHMLAK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaaaattcaaaattttggagaatgttcgatccctagtccggcggactatgaa
tattatacaagtgatacttctagattgatattcagaacggtatttcaatctaaagaggat
tggaattcttatgtccaagaaggtcctgattttttcgaacaggctggtcctagagaaaag
atttattttaatcctcaagaagtaactgcagggattgttacatgtggggggctttgccct
ggaatcaacgacgtgattcgtggaatcgtaatggaactttactatcgttacggagtttcc
agaattttaggttttccttatgggtatcaaggtcttgtaaagagatactctcatcagcca
attgaactcactccagaaaaagtagcgcatatcgtagatgaaggcggatctatgttatct
tcttcgagaggaaatcaatctcccgaagaaatggtggatagtcttagtttttatggagtg
aaaatacttttttgtattggaggagatggaactctcagaggggctagaacaatcgtggat
gaaattgcaaaaaggaaagaaaaaatttccgtagtaggaattccaaaaacgattgataac
gacatcaactacgtacaaaaaacattcggtttttctactgcgttttccaaagcaatggaa
gcggtagagtgcgctcatgtggaagcaaagggagcgccgaatggaattgggcttgtaaag
ttgatggggcgtcattccggatttattgcggtcaacgcggctttggcttctagaaatgta
aattattgtctaattccagaagtggactttgatctatttggaaacgaggcctttttagac
gatctcaaaaaaagaatccaaaaaaaaggacacgctgttatcattgtagcagaaggagct
ggtcaaaaattttttgattctacggaagaaagagattcttccggaaatttaaaactcaaa
gacattggactttttctaaaagatacgatgactgagttttttaaaaaggaaaatattccg
gtaaacatcaaatatatcgatcctagttatattattcgatcaattccggctaacgcagaa
gattctgtattttgtggttttctggctcaaaatgctgtacacgccggtatggcgggaaaa
acggatatggtggtgggaatgtggaataacgtgtttacacatcttccgatttcagttgca
attcaggaaagaaaagttctacagccagatcgaagcactctttggagatcacttttggct
tctacggggcagccggctcacatgttggcgaaatag

DBGET integrated database retrieval system