KEGG   Leptospira interrogans serovar Lai 56601: LB_262Help
Entry
LB_262            CDS       T00098                                 

Gene name
galF
Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lil00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LB_262 (galF)
   00052 Galactose metabolism
    LB_262 (galF)
   00500 Starch and sucrose metabolism
    LB_262 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    LB_262 (galF)
Enzymes [BR:lil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LB_262 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(259249..260622)
Genome map
AA seq 457 aa AA seqDB search
MTSEGLSSAFIQDFLKKTDLVRNGETGMVRWEEVGDLDPKADEITLEQIESENAPEPSIL
KNLVVIKLNGGLGTSMGLSGPKSLIELKNGMSFLEIVAKQSEVIEKKYNVSVPLILMDSF
NTQKESQEELNRIGFRQKFPTSFLQHKVPRLLKKDLTPISCKNPDEEWCPPGHGDIWISL
LETGLLDTLIQNGYKIAFVSNGDNLGATVHPGILSYMLKEKLEFCMEMTPKTLADKKGGA
IYKRMVAGRAENYQLLETAQVPPEHMHEFEGLGKFRTFSTNNLWIDLVALRQRILLGSFE
LSLIVNPKTIEGQEVLQLETAMGSAIRNFEKVKGIIIPRDRFAPVKKCEDYLARRSDAYH
LLENYSITMSDKRKESGLGEILIYLDERYYKKIGDFNRLFPEIPSLELCSSLTVQGEVLF
DQKISIVGEVVIQNNETLPRRISDLKTRILESGKYSF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgaaggtttatcttctgcttttatccaagactttttgaaaaaaaccgatctg
gttcgaaacggagaaaccggaatggttcgctgggaagaagtaggagatctagatcctaaa
gcggacgagattactttagaacaaattgaaagtgagaatgctcccgagccttcgattctt
aaaaacttagtcgttatcaaactcaatggtggacttggaacttctatgggactctccggt
cctaaatctttaattgaactcaaaaatggaatgtcctttttagaaatcgttgcgaaacaa
tctgaggtcattgaaaaaaaatataatgtgtctgttcctttgattctaatggacagtttt
aatacacaaaaggaaagtcaagaggagttgaatcggatcggattccgtcaaaaatttccc
acttcttttttacaacataaagtgcctcgtcttttgaaaaaggacctaacacctattagc
tgcaagaatccggatgaagaatggtgtcctcccggtcacggtgatatatggatttctctt
ttggaaactgggcttttagacactctcattcaaaacggatacaaaattgcttttgtatcc
aacggagacaacttaggagctacggtacatccaggaattctttcctatatgttgaaagag
aaactggaattttgtatggagatgactcctaaaactcttgcggataaaaagggcggagcg
atctacaaaagaatggttgccggaagagcggagaattatcaactcctcgaaacggctcag
gttccacccgaacacatgcacgaatttgaaggtttaggtaagttcaggactttttcaaca
aacaatctttggatcgatttggttgcccttcgacaaagaattcttctcggaagttttgaa
ctttctctgattgtaaatccaaaaacgatcgaaggacaagaagttctacagctcgaaact
gcgatgggttccgcgatccgaaattttgaaaaggtcaaagggatcatcattcctagagat
agatttgctcctgtaaaaaagtgcgaggattacctcgctcgtagatcggatgcgtatcac
cttttagaaaactattctattaccatgtccgacaaaagaaaagaatccgggttaggcgaa
atactgatttatctggatgaaagatattacaaaaagattggagactttaatcgacttttt
ccagaaattccttctttagaactttgttcttctcttaccgttcaaggagaagttctattc
gatcaaaaaatttccatcgtgggagaggttgtaattcaaaataacgaaacactacctcgg
agaatatcagatttaaaaactagaattttagaatctggaaaatattccttttaa

DBGET integrated database retrieval system