KEGG   Limnohabitans sp. 103DPR2: L103DPR2_00031Help
Entry
L103DPR2_00031    CDS       T04120                                 

Gene name
thlA_1
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lim00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    L103DPR2_00031 (thlA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    L103DPR2_00031 (thlA_1)
   00640 Propanoate metabolism
    L103DPR2_00031 (thlA_1)
   00650 Butanoate metabolism
    L103DPR2_00031 (thlA_1)
  Lipid metabolism
   00071 Fatty acid degradation
    L103DPR2_00031 (thlA_1)
   00072 Synthesis and degradation of ketone bodies
    L103DPR2_00031 (thlA_1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L103DPR2_00031 (thlA_1)
   00310 Lysine degradation
    L103DPR2_00031 (thlA_1)
   00380 Tryptophan metabolism
    L103DPR2_00031 (thlA_1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L103DPR2_00031 (thlA_1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L103DPR2_00031 (thlA_1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    L103DPR2_00031 (thlA_1)
Enzymes [BR:lim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     L103DPR2_00031 (thlA_1)
Exosome [BR:lim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L103DPR2_00031 (thlA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(38366..39568)
Genome map
AA seq 400 aa AA seqDB search
MTPSHDPVVIVSAARTPMGSFQGDFASLAAHDLGGAAIKAAVERAAAGSKFSADLVTEVL
FGNCLMAGQGQAPARQAGFKGGLPKSAGAVTMSKMCGSGMRAAMFAHDMLVAGTHDVLVA
GGMESMTNAPYLMLKGRGGYRMGHDKIYDHMMLDGLEDAYEAGRSMGTFGEDCAAKYNFS
RAEQDAFAIASVERAKAATASGAFQAEITPVTFKTRAGETTVSVDEGPGKVKLDKVTSLK
PAFKKDGTITAASSSSINDGAAALVMMRQSTADKLGCKPLARIVSHATHAQEPEWFATAP
VGATQKALAKAGWTVGDVDLWEVNEAFAVVPMALMKELNVPHEKVNVNGGACALGHPIGA
SGARIMVTLIHALKARGLKKGLATLCIGGGEGTAVALELV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaccccatcacatgaccccgtcgtcatcgtcagcgcagcacgcacgcccatgggcagc
tttcagggtgactttgcgtccttggcggcacacgacttgggcggcgctgccatcaaagcg
gccgtagaacgtgccgctgcaggttcaaagttcagtgccgatttggtgactgaagtgttg
tttggcaattgcctgatggcaggccaaggccaagcacctgcgcgtcaagcaggcttcaaa
ggcggtctgcccaagagtgcaggcgccgtcaccatgtccaagatgtgtggctctggcatg
cgcgccgccatgtttgcgcacgacatgttggtagcaggtacgcacgatgtgttggtggct
ggcggcatggaaagcatgaccaacgcaccctacttgatgctcaagggccgcggtggttat
cgcatgggccacgacaaaatttacgaccacatgatgctcgatggtttggaagacgcgtac
gaagccggccgctccatgggcacctttggtgaagactgcgctgccaagtacaacttctcg
cgcgcagagcaagacgcctttgccattgccagcgtagagcgtgccaaggccgctacagcc
tccggtgcattccaagcagaaatcacgcctgtcaccttcaaaacacgtgccggtgaaacc
accgtgtctgtggacgaaggtcccggcaaagtgaagctagacaaagtgaccagcttgaaa
cctgcgttcaaaaaagacggcaccatcaccgccgcttctagctcttccatcaacgatggc
gctgcagcactggtcatgatgcgtcaaagcaccgcagacaaattgggatgcaaacctttg
gcacgcattgtgagccacgccacacacgcgcaagaacctgaatggtttgccacagcccca
gtgggtgccacgcaaaaagccttggccaaagccggttggactgttggcgatgtggacttg
tgggaagtgaacgaagcctttgctgtggtgcccatggccctcatgaaagagctcaatgtg
ccacacgagaaggtgaacgtgaacggtggtgcgtgcgccttgggtcacccgattggcgca
tccggtgcgcgcatcatggtgacgctcattcacgcactcaaagcacgtggcctgaaaaaa
ggtttggccacactgtgcatcggtggcggtgaaggcactgcggtcgcgttggaattggtt
taa

DBGET integrated database retrieval system