KEGG   Limnohabitans sp. 103DPR2: L103DPR2_02293Help
Entry
L103DPR2_02293    CDS       T04120                                 

Gene name
bktB_2
Definition
(GenBank) Beta-ketothiolase BktB
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lim00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    L103DPR2_02293 (bktB_2)
   00630 Glyoxylate and dicarboxylate metabolism
    L103DPR2_02293 (bktB_2)
   00640 Propanoate metabolism
    L103DPR2_02293 (bktB_2)
   00650 Butanoate metabolism
    L103DPR2_02293 (bktB_2)
  Lipid metabolism
   00071 Fatty acid degradation
    L103DPR2_02293 (bktB_2)
   00072 Synthesis and degradation of ketone bodies
    L103DPR2_02293 (bktB_2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L103DPR2_02293 (bktB_2)
   00310 Lysine degradation
    L103DPR2_02293 (bktB_2)
   00380 Tryptophan metabolism
    L103DPR2_02293 (bktB_2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L103DPR2_02293 (bktB_2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L103DPR2_02293 (bktB_2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    L103DPR2_02293 (bktB_2)
Enzymes [BR:lim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     L103DPR2_02293 (bktB_2)
Exosome [BR:lim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L103DPR2_02293 (bktB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2381456..2382640
Genome map
AA seq 394 aa AA seqDB search
MSREVVVVSGVRTAIGTFGGSLKDIAPTELGAQVVREALKRANTDGKDVGHVVFGHVVNT
EPKDMYLSRVAAINGGCAEGTPAFNVNRLCGSGLQAIISASQSILLGDADVAIGGGAENM
SRAPYASLATRFGARMGDTKMIDMMVGALHDPFHTIHMGVTAENIAAKWGITREDQDKLA
VESHNRAERATQAGYFKDQIMPVMLKTRKGEVAYDTDEHFRPGCTVEELAKLKPVFVKEN
GTVTAGNASGINDAAAAVVLMEAGAAKARGAKPLARLVAYAHAGVDPKYMGIGPVPATQL
ALKKAGLTVNDLDVIEANEAFAAQACAVTRDLGLDPAKVNPNGSGISLGHPIGATGALIT
VKALHELQRVNGRYALVTMCIGGGQGIAAIFERM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtgaagttgttgttgtcagcggtgttcgcaccgccattggtacttttggtggc
agcctgaaagacattgcccccacagaattgggcgcacaagtggtgcgcgaagcgctgaag
cgcgccaacaccgatggcaaagatgtgggtcatgtggtgttcggccatgtggtcaacacc
gagcccaaagacatgtacttgtcgcgcgttgcggccatcaacggtggctgcgcagaaggc
acccccgcattcaatgtgaaccgcctgtgcggttctggcttgcaagccatcatttcagcc
agccagtccattttgttgggcgacgccgatgtggccattggtggtggcgccgaaaacatg
agccgtgcgccttatgccagtctggccacacgctttggtgcgcgcatgggcgataccaaa
atgatcgacatgatggttggcgccttgcacgaccctttccacaccattcacatgggcgtg
acggccgagaacattgccgccaagtggggcatcacccgcgaagaccaagacaagttggcc
gttgaaagtcacaaccgcgcagagcgcgccacgcaagcgggctacttcaaagaccaaatc
atgccggtcatgctcaaaacacgcaaaggggaagtggcctatgacaccgacgaacacttc
cgacctggctgcaccgtggaagagttggccaaactcaagcccgtgttcgtcaaagaaaac
ggtaccgtgactgcaggcaacgcatcgggcatcaacgacgctgcagcggcagtggtgttg
atggaggcaggtgctgccaaagcacgcggcgccaagccgttggcacgtttggtggcctac
gcacacgccggcgttgaccccaagtacatgggcattggccctgtacccgcaacacagttg
gctttgaaaaaagcgggcctcacagtcaatgatttggacgtgattgaagccaacgaagcc
tttgctgcgcaagcctgcgccgtcacacgcgacttgggcttggaccctgccaaggtcaac
cccaatggctctggcatttctttgggtcaccccattggtgccacaggcgcgctgattacc
gtcaaagctttacacgagttgcagcgcgtcaacggtcgctacgccttggtgaccatgtgc
attggcggcggtcaaggcattgccgctatttttgaacgcatgtaa

DBGET integrated database retrieval system