KEGG   Listeria innocua: lin0256Help
Entry
lin0256           CDS       T00067                                 

Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lin  Listeria innocua
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lin00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
255724..256539
Genome map
AA seq 271 aa AA seqDB search
MKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAVARAVQMAKDGAEIIDIGGISTRPG
FSEVTPEEELARIIPVIKAVRNALPDIWISVDTWRAEVAEQAVLAGADMINDQWGAKKEP
KIAEVAAKYGIPICLMHNRENTQYQDFLEDVKKDLLESVAIAKAAAVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPLDRMEGTGATTVYGFAKG
CTITRVHDVLPIARMVRMTDAITGKLDITKL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagtggaaaagggatcacctaggtatggtcatgggaatattgaatgttacgcca
gactctttttcagacggcggaaaatatatgcaagtagaagaagctgtagctcgagctgta
caaatggcgaaagatggagcggaaattatcgacattggtggaatttctactcggccgggt
ttttcggaagttacaccagaagaagaacttgcacgaattattccggttattaaagctgtt
agaaatgctcttccagatatatggatttcagttgatacttggcgagcggaagtagcggaa
caagccgttttagctggagctgacatgataaatgatcaatggggtgcgaaaaaagaaccg
aaaattgctgaagttgcagcgaagtatggtataccgatttgtttaatgcataaccgagaa
aatacgcaatatcaagatttcttagaggatgtgaagaaagatttattagagagtgttgca
atcgctaaagcagcagctgtgccagatgaacatatcattttagatccaggctttggattc
gttaaaacaccagctcaaaatttagaagtattgcgccgtattgatgaaattgtcgcactt
ggctatgaagtcctgcttggaacaagtcgaaaatcaactattggtttggtgcttggaact
actcctctagatagaatggaaggaactggcgcaacaacagtttacggatttgcaaaagga
tgtacaattactcgtgtacatgatgtacttccgatagctcgcatggtacggatgacagat
gcgattactggtaaattagatattacaaaattataa

DBGET integrated database retrieval system