KEGG   Listeria innocua: lin0256Help
Entry
lin0256           CDS       T00067                                 

Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lin  Listeria innocua
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lin0256
Enzymes [BR:lin01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     lin0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
255724..256539
Genome map
AA seq 271 aa AA seqDB search
MKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAVARAVQMAKDGAEIIDIGGISTRPG
FSEVTPEEELARIIPVIKAVRNALPDIWISVDTWRAEVAEQAVLAGADMINDQWGAKKEP
KIAEVAAKYGIPICLMHNRENTQYQDFLEDVKKDLLESVAIAKAAAVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPLDRMEGTGATTVYGFAKG
CTITRVHDVLPIARMVRMTDAITGKLDITKL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagtggaaaagggatcacctaggtatggtcatgggaatattgaatgttacgcca
gactctttttcagacggcggaaaatatatgcaagtagaagaagctgtagctcgagctgta
caaatggcgaaagatggagcggaaattatcgacattggtggaatttctactcggccgggt
ttttcggaagttacaccagaagaagaacttgcacgaattattccggttattaaagctgtt
agaaatgctcttccagatatatggatttcagttgatacttggcgagcggaagtagcggaa
caagccgttttagctggagctgacatgataaatgatcaatggggtgcgaaaaaagaaccg
aaaattgctgaagttgcagcgaagtatggtataccgatttgtttaatgcataaccgagaa
aatacgcaatatcaagatttcttagaggatgtgaagaaagatttattagagagtgttgca
atcgctaaagcagcagctgtgccagatgaacatatcattttagatccaggctttggattc
gttaaaacaccagctcaaaatttagaagtattgcgccgtattgatgaaattgtcgcactt
ggctatgaagtcctgcttggaacaagtcgaaaatcaactattggtttggtgcttggaact
actcctctagatagaatggaaggaactggcgcaacaacagtttacggatttgcaaaagga
tgtacaattactcgtgtacatgatgtacttccgatagctcgcatggtacggatgacagat
gcgattactggtaaattagatattacaaaattataa

DBGET integrated database retrieval system